StarFunc result for job id Q14103

User Input

>input (355 residues)
MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGS
AESEGAKIDASKNEEDEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKF
GEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEP
VKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIM
EKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGGPSQNWNQGYSNYWNQ
GYGNYGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKPY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A1LU37	0.550	0.550	6.372E-57	355	1.000	1.000	A1LU37.pdb.gz
2	AFDB:A0A2R8QRA0	0.513	0.575	4.801E-44	314	0.676	0.764	A0A2R8QRA0.pdb.gz
3	AFDB:Q99729	0.461	0.489	2.830E-37	332	0.569	0.608	Q99729.pdb.gz	ROAA_HUMAN Heterogeneous nuclear ribonucleoprotein A/B OS=Homo sapiens OX=9606 GN=HNRNPAB PE=1 SV=2
4	AFDB:Q7ZYE9	0.508	0.552	4.342E-37	324	0.580	0.636	Q7ZYE9.pdb.gz	Q7ZYE9_XENLA Heterogeneous nuclear ribonucleoprotein A/B L homeolog OS=Xenopus laevis OX=8355 GN=hnrnpab.L PE=1 SV=1
5	AFDB:A0A024RDB5	0.452	0.389	2.128E-36	420	0.575	0.486	A0A024RDB5.pdb.gz
6	AFDB:Q99020	0.435	0.526	1.228E-33	285	0.470	0.586	Q99020.pdb.gz	ROAA_MOUSE Heterogeneous nuclear ribonucleoprotein A/B OS=Mus musculus OX=10090 GN=Hnrnpab PE=1 SV=1
7	AFDB:A0A024RB53	0.275	0.302	7.855E-26	320	0.301	0.334	A0A024RB53.pdb.gz	A0A024RB53_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
8	AFDB:Q6URK4	0.281	0.263	3.015E-25	379	0.321	0.301	Q6URK4.pdb.gz	ROA3_RAT Heterogeneous nuclear ribonucleoprotein A3 OS=Rattus norvegicus OX=10116 GN=Hnrnpa3 PE=1 SV=1
9	AFDB:Q8IMS8	0.376	0.234	3.205E-25	634	0.321	0.180	Q8IMS8.pdb.gz	Q8IMS8_DROME FI20028p1 OS=Drosophila melanogaster OX=7227 GN=msi PE=1 SV=2
10	AFDB:A0A024RAZ7	0.284	0.273	5.227E-25	372	0.313	0.298	A0A024RAZ7.pdb.gz
11	PDB:7oqcF	0.211	0.278	6.107E-12	267	0.118	0.157	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
12	PDB:6y53o	0.209	0.452	6.492E-12	160	0.118	0.263	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
13	PDB:5vsuA	0.239	0.222	8.813E-12	387	0.096	0.088	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
14	PDB:6r5kH	0.222	0.203	6.765E-10	394	0.144	0.129	6r5kH.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
15	PDB:5lsbA	0.201	0.397	7.803E-9	176	0.070	0.142	5lsbA.pdb.gz
16	PDB:7evoD	0.210	0.366	1.952E-8	200	0.101	0.180	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
17	PDB:6y5qq	0.203	0.389	5.192E-8	178	0.090	0.180	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
18	PDB:5yzg1	0.238	0.327	1.299E-7	243	0.115	0.169	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
19	PDB:6ff7X	0.190	0.371	3.057E-7	171	0.101	0.211	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
20	PDB:7dvqY	0.222	0.543	1.693E-6	140	0.068	0.171	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H0Y8G5	0.0	525	260	0.704	0.962	H0Y8G5_HUMAN Heterogeneous nuclear ribonucleoprotein D (Fragment) OS=Homo sapiens OX=9606 GN=HNRNPD PE=1 SV=8
2	Q14103	0.0	723	355	1.000	1.000	HNRPD_HUMAN Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens OX=9606 GN=HNRNPD PE=1 SV=1
3	Q60668	0.0	700	355	0.975	0.975	HNRPD_MOUSE Heterogeneous nuclear ribonucleoprotein D0 OS=Mus musculus OX=10090 GN=Hnrnpd PE=1 SV=2
4	Q9JJ54	0.0	699	353	0.966	0.972	HNRPD_RAT Heterogeneous nuclear ribonucleoprotein D0 OS=Rattus norvegicus OX=10116 GN=Hnrnpd PE=1 SV=2
5	F1Q8A5	3.12e-139	399	314	0.696	0.787	F1Q8A5_DANRE Heterogeneous nuclear ribonucleoprotein D OS=Danio rerio OX=7955 GN=wu:fa28b06 PE=1 SV=1
6	A4QP67	2.90e-138	397	314	0.693	0.783	A4QP67_DANRE Heterogeneous nuclear ribonucleoprotein D0 OS=Danio rerio OX=7955 GN=wu:fa28b06 PE=1 SV=1
7	O14979	7.34e-111	331	420	0.524	0.443	HNRDL_HUMAN Heterogeneous nuclear ribonucleoprotein D-like OS=Homo sapiens OX=9606 GN=HNRNPDL PE=1 SV=3
8	Q9Z130	1.65e-109	323	301	0.527	0.621	HNRDL_MOUSE Heterogeneous nuclear ribonucleoprotein D-like OS=Mus musculus OX=10090 GN=Hnrnpdl PE=1 SV=1
9	D6RBZ0	1.34e-107	320	327	0.532	0.578	D6RBZ0_HUMAN Heterogeneous nuclear ribonucleoprotein A/B OS=Homo sapiens OX=9606 GN=HNRNPAB PE=1 SV=1
10	Q99729	1.79e-104	312	332	0.530	0.566	ROAA_HUMAN Heterogeneous nuclear ribonucleoprotein A/B OS=Homo sapiens OX=9606 GN=HNRNPAB PE=1 SV=2
11	F7F9P3	3.97e-104	310	311	0.468	0.534	F7F9P3_RAT Heterogeneous nuclear ribonucleoprotein A/B OS=Rattus norvegicus OX=10116 GN=Hnrnpab PE=1 SV=1
12	Q7ZYE9	1.63e-102	306	324	0.510	0.559	Q7ZYE9_XENLA Heterogeneous nuclear ribonucleoprotein A/B L homeolog OS=Xenopus laevis OX=8355 GN=hnrnpab.L PE=1 SV=1
13	Q9QX80	5.57e-99	296	285	0.414	0.516	Q9QX80_RAT CArG-binding factor A OS=Rattus norvegicus OX=10116 GN=Hnrnpab PE=2 SV=1
14	D6R9P3	2.63e-98	294	280	0.403	0.511	D6R9P3_HUMAN Heterogeneous nuclear ribonucleoprotein A/B OS=Homo sapiens OX=9606 GN=HNRNPAB PE=1 SV=1
15	D6RD18	2.91e-98	294	283	0.403	0.505	D6RD18_HUMAN Heterogeneous nuclear ribonucleoprotein A/B OS=Homo sapiens OX=9606 GN=HNRNPAB PE=1 SV=1
16	A0A8J8XXQ6	5.63e-98	294	298	0.414	0.493	A0A8J8XXQ6_RAT Heterogeneous nuclear ribonucleoprotein A/B OS=Rattus norvegicus OX=10116 GN=Hnrnpab PE=1 SV=1
17	Q99020	6.44e-98	293	285	0.400	0.498	ROAA_MOUSE Heterogeneous nuclear ribonucleoprotein A/B OS=Mus musculus OX=10090 GN=Hnrnpab PE=1 SV=1
18	A0A087WUK2	2.58e-96	292	363	0.377	0.369	A0A087WUK2_HUMAN Heterogeneous nuclear ribonucleoprotein D like OS=Homo sapiens OX=9606 GN=HNRNPDL PE=1 SV=1
19	Q920Q6	1.83e-50	173	346	0.290	0.298	MSI2H_MOUSE RNA-binding protein Musashi homolog 2 OS=Mus musculus OX=10090 GN=Msi2 PE=1 SV=1
20	Q96DH6	4.18e-50	172	328	0.279	0.302	MSI2H_HUMAN RNA-binding protein Musashi homolog 2 OS=Homo sapiens OX=9606 GN=MSI2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08143 CBFNT	1.4e-09	50.6	CBFNT (NUC161) domain
2	PF07292 NID	1.1	21.1	Nmi/IFP 35 domain (NID)
3	PF14605 Nup35_RRM_2	6.4	18.2	Nup53/35/40-type RNA recognition motif
4	PF00076 RRM_1	1.6e-32	122.4	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
5	PF08777 RRM_3	0.004	28.5	RNA binding motif
6	PF16367 RRM_7	2.2e-15	67.9	RNA recognition motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010357220.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010351586.1	0.965	Heterogeneous nuclear ribonucleoprotein U
2	61622.XP_010364478.1	0.960	Eukaryotic translation initiation factor 4 gamma 1
3	61622.XP_010373232.1	0.953	Polypyrimidine tract-binding protein 1 isoform X1
4	61622.XP_010379242.1	0.952	Heterogeneous nuclear ribonucleoprotein L isoform X1
5	61622.XP_010374447.1	0.927	Heterogeneous nuclear ribonucleoprotein F
6	61622.XP_010359253.1	0.925	Exosome component 2
7	61622.XP_010354836.1	0.906	Heterogeneous nuclear ribonucleoprotein A2/B1
8	61622.XP_010380701.1	0.902	Heterogeneous nuclear ribonucleoprotein A3
9	61622.XP_010361441.1	0.899	poly(A) binding protein interacting protein 1
10	61622.XP_010385735.1	0.888	Belongs to the small heat shock protein (HSP20) family.
11	61622.XP_010382274.1	0.885	Synaptotagmin binding cytoplasmic RNA interacting protein
12	61622.XP_010357733.1	0.883	poly(rC)-binding protein 1-like
13	61622.XP_010362558.1	0.883	poly(rC)-binding protein 1
14	61622.XP_010379109.1	0.883	Heterogeneous nuclear ribonucleoprotein U-like protein 1 isoform X1
15	61622.XP_010358263.1	0.872	Heat shock 70 kDa protein 4
16	61622.XP_010358062.1	0.865	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 211 ESTs, 22 Proteins, and 82% coverage of the annotated genomic feature by RNAseq alignments
17	61622.XP_010370239.1	0.865	Nuclease-sensitive element-binding protein 1
18	61622.XP_010362635.1	0.864	Eukaryotic translation initiation factor 4 gamma 3 isoform X1
19	61622.XP_010377209.1	0.863	Transportin-1 isoform X1
20	61622.XP_010354187.1	0.857	Heterogeneous nuclear ribonucleoprotein C (C1/C2)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:0005515	0.998	protein binding
GO:0003729	0.987	mRNA binding
GO:0003677	0.628	DNA binding
GO:0003730	0.374	mRNA 3'-UTR binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0043170	0.992	macromolecule metabolic process
GO:0006139	0.990	nucleobase-containing compound metabolic process
GO:1903311	0.987	regulation of mRNA metabolic process
GO:0061013	0.984	regulation of mRNA catabolic process
GO:0048518	0.978	positive regulation of biological process
GO:0090304	0.978	nucleic acid metabolic process
GO:0016070	0.973	RNA metabolic process
GO:1903312	0.970	negative regulation of mRNA metabolic process
GO:0043488	0.965	regulation of mRNA stability
GO:1902369	0.965	negative regulation of RNA catabolic process
GO:0009889	0.915	regulation of biosynthetic process
GO:0010556	0.912	regulation of macromolecule biosynthetic process
GO:1902373	0.912	negative regulation of mRNA catabolic process
GO:0031326	0.911	regulation of cellular biosynthetic process
GO:0045935	0.827	positive regulation of nucleobase-containing compound metabolic process
GO:0043489	0.777	RNA stabilization
GO:0016071	0.758	mRNA metabolic process
GO:0048255	0.754	mRNA stabilization
GO:0050896	0.463	response to stimulus
GO:0010467	0.449	gene expression
GO:0034248	0.399	regulation of amide metabolic process
GO:0006396	0.347	RNA processing
GO:0051246	0.330	regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.960	cytoplasm
GO:0032991	0.939	protein-containing complex
GO:0005829	0.884	cytosol
GO:1990904	0.577	ribonucleoprotein complex
GO:0030054	0.306	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]