StarFunc result for job id Q14112

User Input

>input (1375 residues)
MEGDRVAGRPVLSSLPVLLLLPLLMLRAAALHPDELFPHGESWGDQLLQEGDDESSAVVK
LANPLHFYEARFSNLYVGTNGIISTQDFPRETQYVDYDFPTDFPAIAPFLADIDTSHGRG
RVLYREDTSPAVLGLAARYVRAGFPRSARFTPTHAFLATWEQVGAYEEVKRGALPSGELN
TFQAVLASDGSDSYALFLYPANGLQFLGTRPKESYNVQLQLPARVGFCRGEADDLKSEGP
YFSLTSTEQSVKNLYQLSNLGIPGVWAFHIGSTSPLDNVRPAAVGDLSAAHSSVPLGRSF
SHATALESDYNEDNLDYYDVNEEEAEYLPGEPEEALNGHSSIDVSFQSKVDTKPLEESST
LDPHTKEGTSLGEVGGPDLKGQVEPWDERETRSPAPPEVDRDSLAPSWETPPPYPENGSI
QPYPDGGPVPSEMDVPPAHPEEEIVLRSYPASGHTTPLSRGTYEVGLEDNIGSNTEVFTY
NAANKETCEHNHRQCSRHAFCTDYATGFCCHCQSKFYGNGKHCLPEGAPHRVNGKVSGHL
HVGHTPVHFTDVDLHAYIVGNDGRAYTAISHIPQPAAQALLPLTPIGGLFGWLFALEKPG
SENGFSLAGAAFTHDMEVTFYPGEETVRITQTAEGLDPENYLSIKTNIQGQVPYVSANFT
AHISPYKELYHYSDSTVTSTSSRDYSLTFGAINQTWSYRIHQNITYQVCRHAPRHPSFPT
TQQLNVDRVFALYNDEERVLRFAVTNQIGPVKEDSDPTPGNPCYDGSHMCDTTARCHPGT
GVDYTCECASGYQGDGRNCVDENECATGFHRCGPNSVCINLPGSYRCECRSGYEFADDRH
TCILITPPANPCEDGSHTCAPAGQARCVHHGGSTFSCACLPGYAGDGHQCTDVDECSENR
CHPAATCYNTPGSFSCRCQPGYYGDGFQCIPDSTSSLTPCEQQQRHAQAQYAYPGARFHI
PQCDEQGNFLPLQCHGSTGFCWCVDPDGHEVPGTQTPPGSTPPHCGPSPEPTQRPPTICE
RWRENLLEHYGGTPRDDQYVPQCDDLGHFIPLQCHGKSDFCWCVDKDGREVQGTRSQPGT
TPACIPTVAPPMVRPTPRPDVTPPSVGTFLLYTQGQQIGYLPLNGTRLQKDAAKTLLSLH
GSIIVGIDYDCRERMVYWTDVAGRTISRAGLELGAEPETIVNSGLISPEGLAIDHIRRTM
YWTDSVLDKIESALLDGSERKVLFYTDLVNPRAIAVDPIRGNLYWTDWNREAPKIETSSL
DGENRRILINTDIGLPNGLTFDPFSKLLCWADAGTKKLECTLPDGTGRRVIQNNLKYPFS
IVSYADHFYHTDWRRDGVVSVNKHSGQFTDEYLPEQRSHLYGITAVYPYCPTGRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O88322	0.464	0.456	0.000	1403	0.804	0.788	O88322.pdb.gz	NID2_MOUSE Nidogen-2 OS=Mus musculus OX=10090 GN=Nid2 PE=1 SV=2
2	AFDB:Q14112	1.000	1.000	0.000	1375	1.000	1.000	Q14112.pdb.gz	NID2_HUMAN Nidogen-2 OS=Homo sapiens OX=9606 GN=NID2 PE=1 SV=3
3	AFDB:Q8IV28	0.235	0.324	0.000	969	0.701	0.995	Q8IV28.pdb.gz	Q8IV28_HUMAN NID2 protein OS=Homo sapiens OX=9606 GN=NID2 PE=1 SV=1
4	PDB:6nqjA	0.135	0.688	1.252E-10	224	0.016	0.098	6nqjA.pdb.gz
5	PDB:6mdra	0.134	0.687	2.287E-10	231	0.020	0.121	6mdra.pdb.gz
6	PDB:2jadA	0.126	0.439	3.974E-10	346	0.017	0.069	2jadA.pdb.gz
7	PDB:4xbiA	0.126	0.404	4.178E-10	376	0.018	0.066	4xbiA.pdb.gz
8	PDB:7bwnJ	0.127	0.533	4.858E-10	280	0.019	0.093	7bwnJ.pdb.gz	Cellular Synthesis and X-ray Crystal Structure of a Designed Protein Heterocatenane.
9	PDB:4jrbA	0.126	0.386	7.260E-10	398	0.015	0.050	4jrbA.pdb.gz
10	PDB:4pfeA	0.127	0.456	7.634E-10	342	0.018	0.073	4pfeA.pdb.gz
11	PDB:5mseC	0.126	0.645	1.200E-9	226	0.018	0.111	5mseC.pdb.gz
12	PDB:7mq8LR	0.160	0.268	1.261E-9	773	0.048	0.085	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:5fguA	0.131	0.328	1.326E-9	494	0.028	0.077	5fguA.pdb.gz
14	AFDB:Q99102	0.149	0.096	6.150E-8	2169	0.097	0.061	Q99102.pdb.gz	MUC4_HUMAN Mucin-4 OS=Homo sapiens OX=9606 GN=MUC4 PE=1 SV=5
15	AFDB:Q9FUY2	0.149	0.212	9.964E-4	931	0.078	0.115	Q9FUY2.pdb.gz	LEUNG_ARATH Transcriptional corepressor LEUNIG OS=Arabidopsis thaliana OX=3702 GN=LUG PE=1 SV=2
16	AFDB:E9Q7X6	0.056	0.058	1.102E-3	1337	0.100	0.103	E9Q7X6.pdb.gz	HEG1_MOUSE Protein HEG homolog 1 OS=Mus musculus OX=10090 GN=Heg1 PE=1 SV=1
17	AFDB:A0A0G2K7W4	0.142	0.145	1.914E-3	1348	0.101	0.103	A0A0G2K7W4.pdb.gz	A0A0G2K7W4_RAT Mitogen-activated protein kinase kinase kinase kinase 4 OS=Rattus norvegicus OX=10116 GN=Map4k4 PE=1 SV=2
18	AFDB:F1LP90	0.137	0.141	3.677E-3	1336	0.103	0.106	F1LP90.pdb.gz	MINK1_RAT Misshapen-like kinase 1 OS=Rattus norvegicus OX=10116 GN=Mink1 PE=1 SV=2
19	AFDB:Q9BYH1	0.049	0.061	4.496E-3	1024	0.076	0.102	Q9BYH1.pdb.gz	SE6L1_HUMAN Seizure 6-like protein OS=Homo sapiens OX=9606 GN=SEZ6L PE=1 SV=1
20	AFDB:P08575	0.049	0.050	5.779E-3	1306	0.046	0.048	P08575.pdb.gz	PTPRC_HUMAN Receptor-type tyrosine-protein phosphatase C OS=Homo sapiens OX=9606 GN=PTPRC PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A4X1WD80	0.0	2037	1348	0.767	0.782	A0A4X1WD80_PIG Nidogen 2 OS=Sus scrofa OX=9823 GN=NID2 PE=4 SV=1
2	B5DFC9	0.0	2157	1396	0.802	0.790	NID2_RAT Nidogen-2 OS=Rattus norvegicus OX=10116 GN=Nid2 PE=2 SV=1
3	O88322	0.0	2145	1403	0.799	0.783	NID2_MOUSE Nidogen-2 OS=Mus musculus OX=10090 GN=Nid2 PE=1 SV=2
4	Q14112	0.0	2846	1375	1.000	1.000	NID2_HUMAN Nidogen-2 OS=Homo sapiens OX=9606 GN=NID2 PE=1 SV=3
5	Q8IV28	0.0	1763	969	0.612	0.869	Q8IV28_HUMAN NID2 protein OS=Homo sapiens OX=9606 GN=NID2 PE=1 SV=1
6	F1RGY5	2.15e-178	567	1309	0.203	0.213	F1RGY5_PIG Nidogen 1 OS=Sus scrofa OX=9823 GN=NID1 PE=1 SV=4
7	P10493	8.21e-175	556	1245	0.199	0.220	NID1_MOUSE Nidogen-1 OS=Mus musculus OX=10090 GN=Nid1 PE=1 SV=2
8	P14543	4.41e-174	554	1247	0.238	0.262	NID1_HUMAN Nidogen-1 OS=Homo sapiens OX=9606 GN=NID1 PE=1 SV=3
9	A1Z877	5.11e-51	200	1350	0.081	0.083	NDG_DROME Nidogen OS=Drosophila melanogaster OX=7227 GN=Ndg PE=1 SV=1
10	B5L5I6	3.99e-46	184	1620	0.068	0.058	B5L5I6_DANRE Low-density lipoprotein receptor-related protein OS=Danio rerio OX=7955 GN=lrp6 PE=1 SV=1
11	A0A2R8PYI8	2.10e-45	181	968	0.073	0.104	A0A2R8PYI8_DANRE Low density lipoprotein receptor-related protein 4 OS=Danio rerio OX=7955 GN=eni PE=4 SV=1
12	C7FZU4	2.38e-45	182	1248	0.105	0.116	C7FZU4_CAEEL Nidogen OS=Caenorhabditis elegans OX=6239 GN=nid-1 PE=1 SV=1
13	Q91VN0	2.38e-45	182	1614	0.071	0.060	LRP5_MOUSE Low-density lipoprotein receptor-related protein 5 OS=Mus musculus OX=10090 GN=Lrp5 PE=1 SV=3
14	B2RYI1	2.44e-45	182	1600	0.071	0.061	B2RYI1_RAT Low-density lipoprotein receptor-related protein OS=Rattus norvegicus OX=10116 GN=Lrp5 PE=2 SV=1
15	F1MAD0	2.78e-45	182	1473	0.071	0.066	F1MAD0_RAT LDL receptor related protein 5 OS=Rattus norvegicus OX=10116 GN=Lrp5 PE=4 SV=3
16	C7FZU3	3.84e-45	181	1527	0.069	0.062	C7FZU3_CAEEL Nidogen OS=Caenorhabditis elegans OX=6239 GN=nid-1 PE=1 SV=1
17	Q93791	4.07e-45	181	1584	0.069	0.060	Q93791_CAEEL Nidogen OS=Caenorhabditis elegans OX=6239 GN=nid-1 PE=1 SV=2
18	O75197	8.64e-45	180	1615	0.069	0.059	LRP5_HUMAN Low-density lipoprotein receptor-related protein 5 OS=Homo sapiens OX=9606 GN=LRP5 PE=1 SV=2
19	A0A8I6G721	1.27e-44	180	1560	0.070	0.062	A0A8I6G721_RAT Low-density lipoprotein receptor-related protein OS=Rattus norvegicus OX=10116 GN=Lrp5 PE=3 SV=1
20	A0A0G2K0H3	1.43e-44	179	1613	0.067	0.057	A0A0G2K0H3_RAT Low-density lipoprotein receptor-related protein OS=Rattus norvegicus OX=10116 GN=Lrp6 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12662 cEGF	1e-16	71.8	Complement Clr-like EGF-like
2	PF00008 EGF	0.00013	33.4	EGF-like domain
3	PF12947 EGF_3	2.7e-28	109.2	EGF domain
4	PF07645 EGF_CA	4.1e-16	70.2	Calcium-binding EGF domain
5	PF12946 EGF_MSP1_1	75	14.8	MSP1 EGF domain 1
6	PF14670 FXa_inhibition	0.022	26.4	Coagulation Factor Xa inhibitory site
7	PF07474 G2F	4.5e-64	227.1	G2F domain
8	PF12661 hEGF	4.1	19.4	Human growth factor-like EGF
9	PF00058 Ldl_recept_b	5.5e-28	108.5	Low-density lipoprotein receptor repeat class B
10	PF06119 NIDO	3.6e-20	83.9	Nidogen-like
11	PF08450 SGL	0.39	21.8	SMP-30/Gluconolactonase/LRE-like region
12	PF00086 Thyroglobulin_1	4.9e-30	114.2	Thyroglobulin type-1 repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000216286

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363827	0.992	Basement membrane-specific heparan sulfate proteoglycan core protein
2	9606.ENSP00000258341	0.970	Laminin subunit gamma-1
3	9606.ENSP00000222399	0.868	Laminin subunit beta-1
4	9606.ENSP00000230538	0.835	Laminin subunit alpha-4
5	9606.ENSP00000252999	0.829	Laminin subunit alpha-5
6	9606.ENSP00000354360	0.828	Laminin subunit gamma-3
7	9606.ENSP00000400365	0.810	Laminin subunit alpha-2
8	9606.ENSP00000388325	0.797	Laminin subunit beta-2
9	9606.ENSP00000324532	0.794	Laminin subunit alpha-3
10	9606.ENSP00000374309	0.792	Laminin subunit alpha-1
11	9606.ENSP00000364979	0.777	Collagen alpha-1(IV) chain
12	9606.ENSP00000264187	0.758	Nidogen-1
13	9606.ENSP00000225964	0.695	Collagen alpha-1(I) chain
14	9606.ENSP00000353654	0.686	Collagen alpha-2(IV) chain
15	9606.ENSP00000368678	0.662	Agrin
16	9606.ENSP00000281741	0.653	Thioredoxin domain containing 16
17	9606.ENSP00000304408	0.621	Collagen alpha-1(III) chain
18	9606.ENSP00000310832	0.621	Cathepsin F
19	9606.ENSP00000360882	0.619	Collagen alpha-1(V) chain
20	9606.ENSP00000351618	0.583	Partitioning defective 3 homolog B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005518	0.985	collagen binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0007155	0.946	cell adhesion
GO:0043062	0.905	extracellular structure organization
GO:0030198	0.885	extracellular matrix organization
GO:0065007	0.501	biological regulation
GO:0050789	0.485	regulation of biological process
GO:0032502	0.458	developmental process
GO:0050794	0.411	regulation of cellular process
GO:0048856	0.399	anatomical structure development
GO:0032501	0.334	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0062023	1.000	collagen-containing extracellular matrix
GO:0005576	0.989	extracellular region
GO:0043226	0.982	organelle
GO:0043227	0.973	membrane-bounded organelle
GO:0016020	0.936	membrane
GO:0005604	0.935	basement membrane
GO:0005615	0.880	extracellular space
GO:0031982	0.860	vesicle
GO:0065010	0.853	extracellular membrane-bounded organelle
GO:0070062	0.838	extracellular exosome
GO:0005622	0.757	intracellular anatomical structure
GO:0043231	0.718	intracellular membrane-bounded organelle
GO:0005886	0.688	plasma membrane
GO:0005737	0.569	cytoplasm
GO:0070013	0.476	intracellular organelle lumen
GO:0012505	0.462	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]