StarFunc result for job id Q14114

User Input

>input (963 residues)
MGLPEPGPLRLLALLLLLLLLLLLQLQHLAAAAADPLLGGQGPAKDCEKDQFQCRNERCI
PSVWRCDEDDDCLDHSDEDDCPKKTCADSDFTCDNGHCIHERWKCDGEEECPDGSDESEA
TCTKQVCPAEKLSCGPTSHKCVPASWRCDGEKDCEGGADEAGCATLCAPHEFQCGNRSCL
AAVFVCDGDDDCGDGSDERGCADPACGPREFRCGGDGGGACIPERWVCDRQFDCEDRSDE
AAELCGRPGPGATSAPAACATASQFACRSGECVHLGWRCDGDRDCKDKSDEADCPLGTCR
GDEFQCGDGTCVLAIKHCNQEQDCPDGSDEAGCLQGLNECLHNNGGCSHICTDLKIGFEC
TCPAGFQLLDQKTCGDIDECKDPDACSQICVNYKGYFKCECYPGYEMDLLTKNCKAAAGK
SPSLIFTNRHEVRRIDLVKRNYSRLIPMLKNVVALDVEVATNRIYWCDLSYRKIYSAYMD
KASDPKEQEVLIDEQLHSPEGLAVDWVHKHIYWTDSGNKTISVATVDGGRRRTLFSRNLS
EPRAIAVDPLRGFMYWSDWGDQAKIEKSGLNGVDRQTLVSDNIEWPNGITLDLLSQRLYW
VDSKLHQLSSIDFSGGNRKTLISSTDFLSHPFGIAVFEDKVFWTDLENEAIFSANRLNGL
EISILAENLNNPHDIVIFHELKQPRAPDACELSVQPNGGCEYLCLPAPQISSHSPKYTCA
CPDTMWLGPDMKRCYRAPQSTSTTTLASTMTRTVPATTRAPGTTVHRSTYQNHSTETPSL
TAAVPSSVSVPRAPSISPSTLSPATSNHSQHYANEDSKMGSTVTAAVIGIIVPIVVIALL
CMSGYLIWRNWKRKNTKSMNFDNPVYRKTTEEEDEDELHIGRTAQIGHVYPAAISSFDRP
LWAEPCLGETREPEDPAPALKELFVLPGEPRSQLHQLPKNPLSELPVVKSKRVALSLEDD
GLP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZE75	0.448	0.453	0.000	953	0.827	0.835	D3ZE75.pdb.gz	D3ZE75_RAT LDL receptor related protein 8 OS=Rattus norvegicus OX=10116 GN=Lrp8 PE=4 SV=4
2	AFDB:Q14114	1.000	1.000	0.000	963	1.000	1.000	Q14114.pdb.gz	LRP8_HUMAN Low-density lipoprotein receptor-related protein 8 OS=Homo sapiens OX=9606 GN=LRP8 PE=1 SV=4
3	AFDB:Q98931	0.437	0.459	0.000	917	0.646	0.678	Q98931.pdb.gz	LRP8_CHICK Low-density lipoprotein receptor-related protein 8 OS=Gallus gallus OX=9031 GN=LRP8 PE=1 SV=1
4	AFDB:Q90W12	0.413	0.469	9.729E-98	847	0.434	0.494	Q90W12.pdb.gz	Q90W12_ONCMY Vitellogenin receptor OS=Oncorhynchus mykiss OX=8022 GN=vtg receptor PE=2 SV=1
5	AFDB:A0A140LGI0	0.313	0.258	1.298E-40	1176	0.189	0.155	A0A140LGI0.pdb.gz
6	PDB:1ri6A	0.209	0.532	1.415E-9	333	0.034	0.099	1ri6A.pdb.gz
7	PDB:2hqsA	0.237	0.525	3.833E-9	412	0.030	0.070	2hqsA.pdb.gz
8	PDB:5c2vB	0.203	0.503	7.048E-9	352	0.034	0.094	5c2vB.pdb.gz	The inner workings of the hydrazine synthase multiprotein complex.
9	PDB:1nr0A	0.211	0.322	1.296E-8	610	0.031	0.049	1nr0A.pdb.gz
10	PDB:6bk8M	0.205	0.527	1.447E-8	326	0.040	0.120	6bk8M.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
11	PDB:7mqaLW	0.179	0.342	1.530E-8	452	0.030	0.064	7mqaLW.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:7mq8LT	0.206	0.226	1.617E-8	869	0.037	0.041	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	AFDB:A0A1P8AW69	0.202	0.192	1.622E-8	1019	0.064	0.061	A0A1P8AW69.pdb.gz	KTN81_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.1 OS=Arabidopsis thaliana OX=3702 GN=KTN80.1 PE=1 SV=1
14	PDB:4gn7A	0.205	0.607	2.973E-8	297	0.031	0.101	4gn7A.pdb.gz	Structural basis of the gamma-lactone-ring formation in ascorbic acid biosynthesis by the senescence marker protein-30/gluconolactonase
15	PDB:7mq8LO	0.147	0.164	3.321E-8	848	0.036	0.041	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:5wyjBA	0.153	0.192	3.510E-8	755	0.036	0.046	5wyjBA.pdb.gz	Molecular architecture of the 90S small subunit pre-ribosome.
17	AFDB:F1LRR4	0.185	0.123	2.070E-7	1551	0.086	0.054	F1LRR4.pdb.gz	F1LRR4_RAT WD repeat domain 62 OS=Rattus norvegicus OX=10116 GN=Wdr62 PE=1 SV=4
18	AFDB:Q9LTT9	0.179	0.133	1.697E-6	1340	0.062	0.045	Q9LTT9.pdb.gz	VCR_ARATH Varicose-related protein OS=Arabidopsis thaliana OX=3702 GN=VCR PE=2 SV=1
19	AFDB:B3H5K9	0.215	0.260	4.115E-6	782	0.072	0.088	B3H5K9.pdb.gz	NEDD1_ARATH Protein NEDD1 OS=Arabidopsis thaliana OX=3702 GN=NEDD1 PE=2 SV=1
20	AFDB:Q8I5B3	0.195	0.225	5.427E-6	822	0.076	0.089	Q8I5B3.pdb.gz	Q8I5B3_PLAF7 Protein transport protein SEC13 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1230700 PE=3 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZTA7	1659	958	0.887	0.891	A0A8I5ZTA7_RAT LDL receptor related protein 8 OS=Rattus norvegicus OX=10116 GN=Lrp8 PE=4 SV=1
2	A0A8I5ZVL7	1219	790	0.651	0.794	A0A8I5ZVL7_RAT LDL receptor related protein 8 OS=Rattus norvegicus OX=10116 GN=Lrp8 PE=4 SV=1
3	A0A8I6A6L0	1136	729	0.599	0.791	A0A8I6A6L0_RAT LDL receptor related protein 8 OS=Rattus norvegicus OX=10116 GN=Lrp8 PE=4 SV=1
4	A0A8I6AE51	926	697	0.480	0.663	A0A8I6AE51_RAT LDL receptor related protein 8 OS=Rattus norvegicus OX=10116 GN=Lrp8 PE=4 SV=1
5	A0A8I6ALZ7	1645	972	0.887	0.879	A0A8I6ALZ7_RAT LDL receptor related protein 8 OS=Rattus norvegicus OX=10116 GN=Lrp8 PE=4 SV=1
6	A0A8I6GFL9	1518	913	0.818	0.863	A0A8I6GFL9_RAT LDL receptor related protein 8 OS=Rattus norvegicus OX=10116 GN=Lrp8 PE=4 SV=1
7	A0A8I6GH61	1291	873	0.734	0.810	A0A8I6GH61_RAT LDL receptor related protein 8 OS=Rattus norvegicus OX=10116 GN=Lrp8 PE=4 SV=1
8	A8JRD0	563	1076	0.350	0.313	A8JRD0_DROME Lipophorin receptor 1, isoform K OS=Drosophila melanogaster OX=7227 GN=LpR1 PE=4 SV=2
9	D3ZE75	1638	999	0.887	0.855	D3ZE75_RAT LDL receptor related protein 8 OS=Rattus norvegicus OX=10116 GN=Lrp8 PE=4 SV=4
10	E9QGD4	788	870	0.423	0.468	E9QGD4_DANRE Low density lipoprotein receptor a OS=Danio rerio OX=7955 GN=ldlr PE=4 SV=1
11	H0Z4W1	783	849	0.401	0.455	H0Z4W1_TAEGU Very low density lipoprotein receptor OS=Taeniopygia guttata OX=59729 GN=VLDLR PE=4 SV=2
12	P01130	811	860	0.441	0.494	LDLR_HUMAN Low-density lipoprotein receptor OS=Homo sapiens OX=9606 GN=LDLR PE=1 SV=1
13	P01131	776	845	0.434	0.495	LDLR_BOVIN Low-density lipoprotein receptor OS=Bos taurus OX=9913 GN=LDLR PE=1 SV=2
14	P35951	794	862	0.438	0.490	LDLR_MOUSE Low-density lipoprotein receptor OS=Mus musculus OX=10090 GN=Ldlr PE=1 SV=2
15	P35952	802	879	0.439	0.481	LDLR_RAT Low-density lipoprotein receptor OS=Rattus norvegicus OX=10116 GN=Ldlr PE=1 SV=1
16	P98155	850	873	0.447	0.493	VLDLR_HUMAN Very low-density lipoprotein receptor OS=Homo sapiens OX=9606 GN=VLDLR PE=1 SV=1
17	P98156	837	873	0.441	0.487	VLDLR_MOUSE Very low-density lipoprotein receptor OS=Mus musculus OX=10090 GN=Vldlr PE=1 SV=1
18	P98165	780	863	0.397	0.443	VLDLR_CHICK Very low-density lipoprotein receptor OS=Gallus gallus OX=9031 GN=VLDLR PE=1 SV=1
19	P98166	837	873	0.442	0.488	VLDLR_RAT Very low-density lipoprotein receptor OS=Rattus norvegicus OX=10116 GN=Vldlr PE=2 SV=1
20	Q14114	1984	963	1.000	1.000	LRP8_HUMAN Low-density lipoprotein receptor-related protein 8 OS=Homo sapiens OX=9606 GN=LRP8 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01731 Arylesterase	4.4e+02	12.5	Arylesterase
2	PF12662 cEGF	0.0031	28.7	Complement Clr-like EGF-like
3	PF16472 DUF5050	1.2	19.9	Domain of unknown function (DUF5050)
4	PF12947 EGF_3	46	15.6	EGF domain
5	PF07645 EGF_CA	0.014	26.9	Calcium-binding EGF domain
6	PF14670 FXa_inhibition	2.1e-09	48.9	Coagulation Factor Xa inhibitory site
7	PF00057 Ldl_recept_a	2.6e-68	237.3	Low-density lipoprotein receptor domain class A
8	PF00058 Ldl_recept_b	4.5e-59	208.0	Low-density lipoprotein receptor repeat class B
9	PF06864 PAP_PilO	42	14.4	Pilin accessory protein (PilO)
10	PF14610 Psg1	1.8e+02	13.4	Ykl077w/Psg1 (Pma1 Stabilization in Golgi)
11	PF08450 SGL	0.00022	32.5	SMP-30/Gluconolactonase/LRE-like region
12	PF15102 TMEM154	16	16.7	TMEM154 protein family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000303634

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000252486	0.999	Apolipoprotein E
2	9606.ENSP00000392423	0.999	Reelin
3	9606.ENSP00000360280	0.997	Disabled homolog 1
4	9606.ENSP00000382428	0.994	Disks large homolog 4
5	9606.ENSP00000241014	0.988	C-Jun-amino-terminal kinase-interacting protein 1
6	9606.ENSP00000420939	0.984	Selenoprotein P
7	9606.ENSP00000421922	0.982	Alpha-2-macroglobulin receptor-associated protein
8	9606.ENSP00000260356	0.978	Thrombospondin-1
9	9606.ENSP00000379818	0.965	Glutamate receptor ionotropic, NMDA 2A
10	9606.ENSP00000205948	0.963	Beta-2-glycoprotein 1
11	9606.ENSP00000346671	0.954	Tyrosine-protein kinase Fyn
12	9606.ENSP00000477213	0.944	Amyloid-beta A4 precursor protein-binding family B member 1
13	9606.ENSP00000346300	0.942	Crk-like protein
14	9606.ENSP00000361263	0.941	Rap guanine nucleotide exchange factor 1
15	9606.ENSP00000477455	0.939	Glutamate receptor ionotropic, NMDA 2B
16	9606.ENSP00000284981	0.937	Amyloid-beta A4 protein
17	9606.ENSP00000007722	0.934	Integrin alpha-3
18	9606.ENSP00000371532	0.932	Very low-density lipoprotein receptor
19	9606.ENSP00000236850	0.930	Apolipoprotein A-I
20	9606.ENSP00000378974	0.930	Mitogen-activated protein kinase 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019894	0.998	kinesin binding
GO:0008035	0.998	high-density lipoprotein particle binding
GO:0004888	0.954	transmembrane signaling receptor activity
GO:0034185	0.948	apolipoprotein binding
GO:0005041	0.926	low-density lipoprotein particle receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.990	response to stimulus
GO:0032501	0.989	multicellular organismal process
GO:0009987	0.989	cellular process
GO:0051716	0.980	cellular response to stimulus
GO:0048856	0.978	anatomical structure development
GO:0021543	0.973	pallium development
GO:0042221	0.965	response to chemical
GO:0010033	0.950	response to organic substance
GO:0021987	0.945	cerebral cortex development
GO:0036314	0.941	response to sterol
GO:0071495	0.881	cellular response to endogenous stimulus
GO:1901701	0.878	cellular response to oxygen-containing compound
GO:0097305	0.859	response to alcohol
GO:0097306	0.852	cellular response to alcohol
GO:0070723	0.834	response to cholesterol
GO:0071363	0.790	cellular response to growth factor stimulus
GO:0036315	0.786	cellular response to sterol
GO:0009410	0.773	response to xenobiotic stimulus
GO:0050794	0.642	regulation of cellular process
GO:0008152	0.378	metabolic process
GO:0071704	0.347	organic substance metabolic process
GO:0051179	0.327	localization
GO:0023052	0.319	signaling
GO:0007154	0.319	cell communication
GO:0044238	0.301	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0043229	0.999	intracellular organelle
GO:0032991	0.998	protein-containing complex
GO:0030054	0.989	cell junction
GO:0071944	0.987	cell periphery
GO:0005886	0.984	plasma membrane
GO:0043232	0.983	intracellular non-membrane-bounded organelle
GO:0030424	0.956	axon
GO:0043025	0.953	neuronal cell body
GO:0005875	0.949	microtubule associated complex
GO:0014069	0.948	postsynaptic density
GO:0030425	0.944	dendrite
GO:0043231	0.856	intracellular membrane-bounded organelle
GO:0005737	0.819	cytoplasm
GO:0012505	0.496	endomembrane system
GO:0031982	0.418	vesicle
GO:0043235	0.413	receptor complex
GO:0045121	0.393	membrane raft
GO:0098590	0.389	plasma membrane region
GO:0044853	0.350	plasma membrane raft

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]