StarFunc result for job id Q14116

User Input

>input (193 residues)
MAAEPVEDNCINFVAMKFIDNTLYFIAEDDENLESDYFGKLESKLSVIRNLNDQVLFIDQ
GNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPRGMAVTISVKCEKISTLSCENKIISFK
EMNPPDNIKDTKSDIIFFQRSVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDEL
GDRSIMFTVQNED

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14116	1.000	1.000	2.860E-34	193	1.000	1.000	Q14116.pdb.gz	IL18_HUMAN Interleukin-18 OS=Homo sapiens OX=9606 GN=IL18 PE=1 SV=1
2	AFDB:O19073	0.892	0.897	3.559E-29	192	0.767	0.771	O19073.pdb.gz	IL18_PIG Interleukin-18 OS=Sus scrofa OX=9823 GN=IL18 PE=2 SV=2
3	AFDB:Q9XSR0	0.830	0.830	2.444E-27	193	0.736	0.736	Q9XSR0.pdb.gz	IL18_CANLF Interleukin-18 OS=Canis lupus familiaris OX=9615 GN=IL18 PE=2 SV=1
4	AFDB:P97636	0.821	0.817	7.062E-23	194	0.627	0.624	P97636.pdb.gz	IL18_RAT Interleukin-18 OS=Rattus norvegicus OX=10116 GN=Il18 PE=2 SV=1
5	AFDB:B3VHV0	0.755	0.736	2.707E-12	198	0.337	0.328	B3VHV0.pdb.gz	B3VHV0_CHICK Interleukin-18 OS=Gallus gallus OX=9031 GN=IL18 PE=2 SV=1
6	AFDB:A0A0R4IYF1	0.628	0.442	1.170E-7	284	0.171	0.116	A0A0R4IYF1.pdb.gz
7	AFDB:A0A060WTK5	0.684	0.520	1.230E-7	260	0.130	0.096	A0A060WTK5.pdb.gz	A0A060WTK5_ONCMY Interleukin-1 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00005489001 PE=3 SV=1
8	AFDB:A3DTN2	0.641	0.476	2.754E-7	267	0.150	0.109	A3DTN2.pdb.gz	A3DTN2_ANAPL Interleukin-1 OS=Anas platyrhynchos OX=8839 PE=2 SV=1
9	AFDB:A0A060Z0U0	0.639	0.497	3.368E-7	254	0.135	0.102	A0A060Z0U0.pdb.gz	A0A060Z0U0_ONCMY Interleukin-1 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00016453001 PE=3 SV=1
10	AFDB:P01582	0.575	0.426	6.482E-7	270	0.181	0.130	P01582.pdb.gz	IL1A_MOUSE Interleukin-1 alpha OS=Mus musculus OX=10090 GN=Il1a PE=1 SV=1
11	PDB:5bowA	0.558	0.697	3.900E-6	151	0.150	0.192	5bowA.pdb.gz
12	PDB:1md6A	0.546	0.668	6.452E-6	154	0.140	0.175	1md6A.pdb.gz
13	PDB:4izeA	0.544	0.673	1.444E-5	152	0.155	0.197	4izeA.pdb.gz
14	PDB:3nbcA	0.550	0.695	1.980E-4	148	0.073	0.095	3nbcA.pdb.gz	Bivalent carbohydrate binding is required for biological activity of Clitocybe nebularis lectin (CNL), the N,N'-diacetyllactosediamine (GalNAc beta 1-4GlcNAc, LacdiNAc)-specific lectin from basidiomycete C. nebularis
15	PDB:6hpiA	0.511	0.606	2.082E-4	158	0.150	0.184	6hpiA.pdb.gz
16	PDB:4qd2B	0.521	0.682	3.115E-4	143	0.104	0.140	4qd2B.pdb.gz	Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex.
17	PDB:1irpA	0.521	0.635	1.641E-3	153	0.145	0.183	1irpA.pdb.gz
18	PDB:4qd2C	0.532	0.374	2.111E-3	286	0.093	0.063	4qd2C.pdb.gz	Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex.
19	PDB:3v0aB	0.475	0.099	2.455E-3	1150	0.104	0.017	3v0aB.pdb.gz	Botulinum neurotoxin is shielded by NTNHA in an interlocked complex.
20	PDB:7ua3A	0.522	0.029	5.494E-3	4443	0.155	0.007	7ua3A.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14116	1.15e-141	394	193	1.000	1.000	IL18_HUMAN Interleukin-18 OS=Homo sapiens OX=9606 GN=IL18 PE=1 SV=1
2	O19073	1.13e-107	308	192	0.767	0.771	IL18_PIG Interleukin-18 OS=Sus scrofa OX=9823 GN=IL18 PE=2 SV=2
3	Q9XSR0	3.38e-103	296	193	0.736	0.736	IL18_CANLF Interleukin-18 OS=Canis lupus familiaris OX=9615 GN=IL18 PE=2 SV=1
4	P97636	2.73e-83	246	194	0.627	0.624	IL18_RAT Interleukin-18 OS=Rattus norvegicus OX=10116 GN=Il18 PE=2 SV=1
5	P70380	1.46e-82	244	192	0.642	0.646	IL18_MOUSE Interleukin-18 OS=Mus musculus OX=10090 GN=Il18 PE=1 SV=2
6	C4P6Q0	1.70e-17	78.6	198	0.373	0.364	C4P6Q0_CHICK Interleukin-18 OS=Gallus gallus OX=9031 GN=IL18 PE=2 SV=1
7	Q9I8D2	3.69e-17	77.8	198	0.373	0.364	Q9I8D2_CHICK Interleukin-18 OS=Gallus gallus OX=9031 GN=IL-18 PE=2 SV=1
8	B3VHV0	5.61e-17	77.0	198	0.363	0.354	B3VHV0_CHICK Interleukin-18 OS=Gallus gallus OX=9031 GN=IL18 PE=2 SV=1
9	E0AFT5	7.60e-17	77.0	198	0.373	0.364	E0AFT5_CHICK Interleukin-18 OS=Gallus gallus OX=9031 PE=2 SV=1
10	D1M7B0	1.13e-16	76.3	198	0.378	0.369	D1M7B0_CHICK Interleukin-18 OS=Gallus gallus OX=9031 GN=IL-18 PE=2 SV=1
11	Q6IT44	3.13e-16	75.1	196	0.358	0.352	Q6IT44_CHICK Interleukin-18 OS=Gallus gallus OX=9031 PE=2 SV=2
12	Q5S4P2	7.09e-16	74.3	198	0.368	0.359	Q5S4P2_CHICK Interleukin-18 OS=Gallus gallus OX=9031 PE=2 SV=1
13	Q8QFQ8	2.31e-15	72.8	196	0.352	0.347	IL18_CHICK Interleukin-18 OS=Gallus gallus OX=9031 GN=IL18 PE=2 SV=1
14	Q1LUQ2	2.1	31.6	566	0.233	0.080	Q1LUQ2_DANRE TIR domain-containing adapter molecule 1 OS=Danio rerio OX=7955 GN=trif PE=2 SV=1
15	Q9NSG2	7.2	29.6	853	0.114	0.026	FIRRM_HUMAN FIGNL1-interacting regulator of recombination and mitosis OS=Homo sapiens OX=9606 GN=FIRRM PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00340 IL1	5.4e-33	124.6	Interleukin-1 / 18

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000280357

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264260	0.999	Interleukin-18 receptor accessory protein
2	9606.ENSP00000387211	0.999	Interleukin-18 receptor 1
3	9606.ENSP00000384212	0.998	Interleukin-18-binding protein
4	9606.ENSP00000433138	0.997	Caspase-1
5	9606.ENSP00000263341	0.994	Interleukin-1 beta
6	9606.ENSP00000385675	0.988	Interleukin-6
7	9606.ENSP00000398698	0.988	Tumor necrosis factor
8	9606.ENSP00000412237	0.988	Interleukin-10
9	9606.ENSP00000263326	0.987	Interleukin-37
10	9606.ENSP00000306512	0.986	Interleukin-8
11	9606.ENSP00000226730	0.985	Interleukin-2
12	9606.ENSP00000231449	0.980	Interleukin-4
13	9606.ENSP00000263339	0.980	Interleukin-1 alpha
14	9606.ENSP00000225831	0.976	C-C motif chemokine 2
15	9606.ENSP00000304915	0.975	Interleukin-13
16	9606.ENSP00000379110	0.975	Growth-regulated alpha protein
17	9606.ENSP00000296871	0.973	Granulocyte-macrophage colony-stimulating factor
18	9606.ENSP00000305651	0.973	C-X-C motif chemokine 10
19	9606.ENSP00000474412	0.972	C-C motif chemokine 5
20	9606.ENSP00000477908	0.972	C-C motif chemokine 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005125	1.000	cytokine activity
GO:0005126	0.700	cytokine receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0009987	0.995	cellular process
GO:0050789	0.995	regulation of biological process
GO:0007166	0.989	cell surface receptor signaling pathway
GO:0032729	0.986	positive regulation of type II interferon production
GO:0002682	0.974	regulation of immune system process
GO:0048522	0.963	positive regulation of cellular process
GO:0002684	0.962	positive regulation of immune system process
GO:0042127	0.915	regulation of cell population proliferation
GO:0006915	0.905	apoptotic process
GO:0008284	0.898	positive regulation of cell population proliferation
GO:0002376	0.883	immune system process
GO:0042221	0.819	response to chemical
GO:0006950	0.818	response to stress
GO:0048583	0.768	regulation of response to stimulus
GO:0032501	0.725	multicellular organismal process
GO:0006955	0.717	immune response
GO:0009605	0.709	response to external stimulus
GO:0006952	0.703	defense response
GO:0097190	0.685	apoptotic signaling pathway
GO:0051171	0.674	regulation of nitrogen compound metabolic process
GO:0080090	0.671	regulation of primary metabolic process
GO:0071345	0.670	cellular response to cytokine stimulus
GO:0050865	0.620	regulation of cell activation
GO:0051707	0.616	response to other organism
GO:0097191	0.603	extrinsic apoptotic signaling pathway
GO:0002694	0.591	regulation of leukocyte activation
GO:0031323	0.584	regulation of cellular metabolic process
GO:0008625	0.537	extrinsic apoptotic signaling pathway via death domain receptors
GO:0051249	0.528	regulation of lymphocyte activation
GO:0002696	0.526	positive regulation of leukocyte activation
GO:0048584	0.517	positive regulation of response to stimulus
GO:0051251	0.505	positive regulation of lymphocyte activation
GO:0048519	0.500	negative regulation of biological process
GO:0051173	0.448	positive regulation of nitrogen compound metabolic process
GO:0032101	0.447	regulation of response to external stimulus
GO:0080134	0.444	regulation of response to stress
GO:0051246	0.442	regulation of protein metabolic process
GO:0031325	0.437	positive regulation of cellular metabolic process
GO:0009966	0.434	regulation of signal transduction
GO:0032502	0.425	developmental process
GO:0048856	0.424	anatomical structure development
GO:0009889	0.411	regulation of biosynthetic process
GO:0031349	0.402	positive regulation of defense response
GO:0032103	0.400	positive regulation of response to external stimulus
GO:0065009	0.386	regulation of molecular function
GO:0031326	0.380	regulation of cellular biosynthetic process
GO:0019219	0.380	regulation of nucleobase-containing compound metabolic process
GO:0009617	0.379	response to bacterium
GO:0010556	0.374	regulation of macromolecule biosynthetic process
GO:0019220	0.367	regulation of phosphate metabolic process
GO:0051252	0.367	regulation of RNA metabolic process
GO:0048523	0.360	negative regulation of cellular process
GO:0031399	0.359	regulation of protein modification process
GO:0051247	0.353	positive regulation of protein metabolic process
GO:0050776	0.348	regulation of immune response
GO:0006355	0.346	regulation of DNA-templated transcription
GO:1902533	0.332	positive regulation of intracellular signal transduction
GO:0044093	0.319	positive regulation of molecular function
GO:0042325	0.310	regulation of phosphorylation
GO:0050727	0.302	regulation of inflammatory response

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0005829	0.979	cytosol
GO:0005615	0.975	extracellular space
GO:0071944	0.912	cell periphery
GO:0016020	0.851	membrane
GO:0043227	0.706	membrane-bounded organelle
GO:0043231	0.431	intracellular membrane-bounded organelle
GO:0005886	0.319	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]