StarFunc result for job id Q14117

User Input

>input (519 residues)
MAAPSRLLIRGGRVVNDDFSEVADVLVEDGVVRALGHDLLPPGGAPAGLRVLDAAGKLVL
PGGIDTHTHMQFPFMGSRSIDDFHQGTKAALSGGTTMIIDFAIPQKGGSLIEAFETWRSW
ADPKVCCDYSLHVAVTWWSDQVKEEMKILVQDKGVNSFKMFMAYKDLYMVTDLELYEAFS
RCKEIGAIAQVHAENGDLIAEGAKKMLALGITGPEGHELCRPEAVEAEATLRAITIASAV
NCPLYIVHVMSKSAAKVIADARRDGKVVYGEPIAASLGTDGTHYWNKEWHHAAHHVMGPP
LRPDPSTPDFLMNLLANDDLTTTGTDNCTFNTCQKALGKDDFTKIPNGVNGVEDRMSVIW
EKGVHSGKMDENRFVAVTSTNAAKIFNLYPRKGRIAVGSDADIVIWDPKGTRTISAKTHH
QAVNFNIFEGMVCHGVPLVTISRGKVVYEAGVFSVTAGDGKFIPRKPFAEYIYKRIKQRD
RTCTPTPVERAPYKGEVATLKSRVTKEDATAGTRKQAHP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14117	1.000	1.000	0.000	519	1.000	1.000	Q14117.pdb.gz	DPYS_HUMAN Dihydropyrimidinase OS=Homo sapiens OX=9606 GN=DPYS PE=1 SV=1
2	AFDB:Q9EQF5	0.981	0.981	0.000	519	0.884	0.884	Q9EQF5.pdb.gz	DPYS_MOUSE Dihydropyrimidinase OS=Mus musculus OX=10090 GN=Dpys PE=1 SV=2
3	PDB:2vr2A	0.917	0.996	2.196E-98	478	0.919	0.998	2vr2A.pdb.gz	The Crystal Structure of Human Dihydropyrimidinase
4	AFDB:A0A1C7CYX9	0.958	0.737	5.643E-88	677	0.593	0.455	A0A1C7CYX9.pdb.gz	A0A1C7CYX9_HUMAN Dihydropyrimidinase like 2 OS=Homo sapiens OX=9606 GN=DPYSL2 PE=1 SV=1
5	AFDB:Q52PJ3	0.951	0.862	2.351E-87	573	0.582	0.527	Q52PJ3.pdb.gz	Q52PJ3_DANRE Collapsin response mediator protein 2 OS=Danio rerio OX=7955 GN=dpysl2 PE=1 SV=1
6	AFDB:Q14195	0.956	0.871	9.229E-87	570	0.582	0.530	Q14195.pdb.gz	DPYL3_HUMAN Dihydropyrimidinase-related protein 3 OS=Homo sapiens OX=9606 GN=DPYSL3 PE=1 SV=1
7	AFDB:Q52PJ5	0.945	0.866	1.171E-86	567	0.572	0.524	Q52PJ5.pdb.gz	DPYL3_DANRE Dihydropyrimidinase-related protein 3 OS=Danio rerio OX=7955 GN=dpysl3 PE=2 SV=1
8	AFDB:X5DNI1	0.945	0.716	1.914E-85	686	0.582	0.440	X5DNI1.pdb.gz	X5DNI1_HUMAN Collapsin response mediator protein 1 isoform A (Fragment) OS=Homo sapiens OX=9606 GN=CRMP1 PE=2 SV=1
9	AFDB:Q9BPU6	0.959	0.883	2.288E-85	564	0.572	0.527	Q9BPU6.pdb.gz	DPYL5_HUMAN Dihydropyrimidinase-related protein 5 OS=Homo sapiens OX=9606 GN=DPYSL5 PE=1 SV=1
10	AFDB:Q9DDZ6	0.951	0.861	4.214E-84	574	0.566	0.512	Q9DDZ6.pdb.gz	Q9DDZ6_CHICK Collapsin response mediator protein-3B OS=Gallus gallus OX=9031 GN=CRMP3B PE=2 SV=1
11	AFDB:Q55DL0	0.934	0.963	4.472E-84	503	0.566	0.584	Q55DL0.pdb.gz	DPYS_DICDI Dihydropyrimidinase OS=Dictyostelium discoideum OX=44689 GN=pyd2 PE=1 SV=1
12	PDB:6jv9B	0.935	0.980	2.637E-83	495	0.586	0.614	6jv9B.pdb.gz
13	PDB:4cnuA	0.924	0.982	1.665E-82	488	0.572	0.609	4cnuA.pdb.gz
14	PDB:2ftwA	0.908	0.973	1.937E-80	484	0.557	0.597	2ftwA.pdb.gz	The Crystal Structures of Dihydropyrimidinases Reaffirm the Close Relationship between Cyclic Amidohydrolases and Explain Their Substrate Specificity.
15	PDB:4b90A	0.921	0.985	5.995E-80	485	0.557	0.596	4b90A.pdb.gz
16	PDB:5nksA	0.906	0.959	4.334E-78	490	0.553	0.586	5nksA.pdb.gz
17	PDB:4b3zD	0.904	0.983	8.336E-78	477	0.565	0.614	4b3zD.pdb.gz
18	PDB:3e74B	0.760	0.904	6.923E-38	433	0.225	0.270	3e74B.pdb.gz	Crystal structure of metal-dependent allantoinase from Escherichia coli
19	PDB:1onxA	0.542	0.702	2.372E-16	389	0.141	0.188	1onxA.pdb.gz	High Resolution X-ray Structure of Isoaspartyl Dipeptidase from Escherichia coli
20	PDB:1a5lC	0.513	0.499	2.928E-14	536	0.145	0.140	1a5lC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A1C7CYX9	650	677	0.599	0.459	A0A1C7CYX9_HUMAN Dihydropyrimidinase like 2 OS=Homo sapiens OX=9606 GN=DPYSL2 PE=1 SV=1
2	E9PD68	640	570	0.574	0.523	E9PD68_HUMAN Collapsin response mediator protein 1 OS=Homo sapiens OX=9606 GN=CRMP1 PE=1 SV=1
3	O02675	651	572	0.603	0.547	DPYL2_BOVIN Dihydropyrimidinase-related protein 2 OS=Bos taurus OX=9913 GN=DPYSL2 PE=1 SV=1
4	O08553	650	572	0.599	0.544	DPYL2_MOUSE Dihydropyrimidinase-related protein 2 OS=Mus musculus OX=10090 GN=Dpysl2 PE=1 SV=2
5	O14531	613	572	0.563	0.510	DPYL4_HUMAN Dihydropyrimidinase-related protein 4 OS=Homo sapiens OX=9606 GN=DPYSL4 PE=1 SV=2
6	O35098	613	572	0.563	0.510	DPYL4_MOUSE Dihydropyrimidinase-related protein 4 OS=Mus musculus OX=10090 GN=Dpysl4 PE=1 SV=1
7	P47942	650	572	0.599	0.544	DPYL2_RAT Dihydropyrimidinase-related protein 2 OS=Rattus norvegicus OX=10116 GN=Dpysl2 PE=1 SV=1
8	P97427	645	572	0.580	0.526	DPYL1_MOUSE Dihydropyrimidinase-related protein 1 OS=Mus musculus OX=10090 GN=Crmp1 PE=1 SV=1
9	Q14117	1078	519	1.000	1.000	DPYS_HUMAN Dihydropyrimidinase OS=Homo sapiens OX=9606 GN=DPYS PE=1 SV=1
10	Q14194	640	572	0.574	0.521	DPYL1_HUMAN Dihydropyrimidinase-related protein 1 OS=Homo sapiens OX=9606 GN=CRMP1 PE=1 SV=1
11	Q14195	646	570	0.578	0.526	DPYL3_HUMAN Dihydropyrimidinase-related protein 3 OS=Homo sapiens OX=9606 GN=DPYSL3 PE=1 SV=1
12	Q16555	650	572	0.599	0.544	DPYL2_HUMAN Dihydropyrimidinase-related protein 2 OS=Homo sapiens OX=9606 GN=DPYSL2 PE=1 SV=1
13	Q18677	595	520	0.547	0.546	DHP2_CAEEL Dihydropyrimidinase 2 OS=Caenorhabditis elegans OX=6239 GN=dhp-2 PE=1 SV=1
14	Q21773	554	489	0.516	0.548	DHP1_CAEEL Dihydropyrimidinase 1 OS=Caenorhabditis elegans OX=6239 GN=dhp-1 PE=1 SV=2
15	Q2XST3	540	589	0.507	0.447	Q2XST3_DROME Dihydropyrimidinase mutant supA4 OS=Drosophila melanogaster OX=7227 GN=CRMP PE=3 SV=1
16	Q52PJ3	643	573	0.586	0.531	Q52PJ3_DANRE Collapsin response mediator protein 2 OS=Danio rerio OX=7955 GN=dpysl2 PE=1 SV=1
17	Q52PJ5	644	567	0.574	0.526	DPYL3_DANRE Dihydropyrimidinase-related protein 3 OS=Danio rerio OX=7955 GN=dpysl3 PE=2 SV=1
18	Q55DL0	616	503	0.568	0.586	DPYS_DICDI Dihydropyrimidinase OS=Dictyostelium discoideum OX=44689 GN=pyd2 PE=1 SV=1
19	Q62188	641	570	0.574	0.523	DPYL3_MOUSE Dihydropyrimidinase-related protein 3 OS=Mus musculus OX=10090 GN=Dpysl3 PE=1 SV=1
20	Q62950	644	572	0.576	0.523	DPYL1_RAT Dihydropyrimidinase-related protein 1 OS=Rattus norvegicus OX=10116 GN=Crmp1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01979 Amidohydro_1	3.5e-31	120.4	Amidohydrolase family
2	PF04909 Amidohydro_2	54	15.0	Amidohydrolase
3	PF07969 Amidohydro_3	3.5e-12	58.2	Amidohydrolase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000276651

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000324343	0.990	Beta-ureidopropionase
2	9606.ENSP00000359211	0.985	Dihydropyrimidine dehydrogenase [NADP(+)]
3	9606.ENSP00000288699	0.873	Dihydropyrimidinase-related protein 5
4	9606.ENSP00000232607	0.832	Uridine 5'-monophosphate synthase
5	9606.ENSP00000456548	0.700	Protein ELFN1
6	9606.ENSP00000309539	0.690	Dihydropyrimidinase-related protein 2
7	9606.ENSP00000343690	0.690	Dihydropyrimidinase-related protein 3
8	9606.ENSP00000371253	0.684	Trifunctional purine biosynthetic protein adenosine-3
9	9606.ENSP00000388713	0.642	LanC-like protein 1
10	9606.ENSP00000378199	0.623	Heat shock-related 70 kDa protein 2
11	9606.ENSP00000338272	0.619	Hairy/enhancer-of-split related with YRPW motif protein 1
12	9606.ENSP00000330032	0.618	Uridine phosphorylase 1
13	9606.ENSP00000381339	0.601	Guanine nucleotide-binding protein G(t) subunit alpha-3
14	9606.ENSP00000230053	0.593	Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 2
15	9606.ENSP00000320219	0.590	Arylsulfatase family member J
16	9606.ENSP00000274353	0.583	Betaine--homocysteine S-methyltransferase 1
17	9606.ENSP00000264705	0.576	CAD protein
18	9606.ENSP00000402608	0.575	Carbamoyl-phosphate synthase [ammonia], mitochondrial
19	9606.ENSP00000360561	0.558	Ectonucleoside triphosphate diphosphohydrolase 8
20	9606.ENSP00000356425	0.554	Ubiquitin carboxyl-terminal hydrolase isozyme L5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0016812	0.999	hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amides
GO:0004157	0.621	dihydropyrimidinase activity
GO:0051219	0.314	phosphoprotein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006139	0.995	nucleobase-containing compound metabolic process
GO:0072527	0.992	pyrimidine-containing compound metabolic process
GO:0044281	0.990	small molecule metabolic process
GO:0044248	0.985	cellular catabolic process
GO:0055086	0.978	nucleobase-containing small molecule metabolic process
GO:0072529	0.966	pyrimidine-containing compound catabolic process
GO:0009112	0.659	nucleobase metabolic process
GO:0006206	0.610	pyrimidine nucleobase metabolic process
GO:0046113	0.558	nucleobase catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043226	0.953	organelle
GO:0043227	0.866	membrane-bounded organelle
GO:0043229	0.785	intracellular organelle
GO:0043231	0.764	intracellular membrane-bounded organelle
GO:0005576	0.568	extracellular region
GO:0043230	0.485	extracellular organelle
GO:0070062	0.480	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.5.2.-	0.999	In cyclic amides.
RHEA:16121	0.621	5,6-dihydrouracil + H2O = 3-(carbamoylamino)propanoate + H(+)
EC:3.5.2.2	0.621	dihydropyrimidinase.

[back to server]