StarFunc result for job id Q14118

User Input

>input (895 residues)
MRMSVGLSLLLPLSGRTFLLLLSVVMAQSHWPSEPSEAVRDWENQLEASMHSVLSDLHEA
VPTVVGIPDGTAVVGRSFRVTIPTDLIASSGDIIKVSAAGKEALPSWLHWDSQSHTLEGL
PLDTDKGVHYISVSATRLGANGSHIPQTSSVFSIEVYPEDHSELQSVRTASPDPGEVVSS
ACAADEPVTVLTVILDADLTKMTPKQRIDLLHRMRSFSEVELHNMKLVPVVNNRLFDMSA
FMAGPGNAKKVVENGALLSWKLGCSLNQNSVPDIHGVEAPAREGAMSAQLGYPVVGWHIA
NKKPPLPKRVRRQIHATPTPVTAIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRD
PVPGKPTVTIRTRGAIIQTPTLGPIQPTRVSEAGTTVPGQIRPTMTIPGYVEPTAVATPP
TTTTKKPRVSTPKPATPSTDSTTTTTRRPTKKPRTPRPVPRVTTKVSITRLETASPPTRI
RTTTSGVPRGGEPNQRPELKNHIDRVDAWVGTYFEVKIPSDTFYDHEDTTTDKLKLTLKL
REQQLVGEKSWVQFNSNSQLMYGLPDSSHVGKHEYFMHATDKGGLSAVDAFEIHVHRRPQ
GDRAPARFKAKFVGDPALVLNDIHKKIALVKKLAFAFGDRNCSTITLQNITRGSIVVEWT
NNTLPLEPCPKEQIAGLSRRIAEDDGKPRPAFSNALEPDFKATSITVTGSGSCRHLQFIP
VVPPRRVPSEAPPTEVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAMICYRKKRK
GKLTLEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSVPETT
PLNQDTMGEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A1D5PFK3	0.383	0.383	0.000	896	0.783	0.782	A0A1D5PFK3.pdb.gz
2	AFDB:O18738	0.448	0.448	0.000	895	0.930	0.930	O18738.pdb.gz	DAG1_BOVIN Dystroglycan 1 OS=Bos taurus OX=9913 GN=DAG1 PE=1 SV=1
3	AFDB:Q5VV43	0.124	0.107	9.922E-8	1072	0.094	0.078	Q5VV43.pdb.gz	K0319_HUMAN Dyslexia-associated protein KIAA0319 OS=Homo sapiens OX=9606 GN=KIAA0319 PE=1 SV=1
4	AFDB:Q6UXM1	0.110	0.092	3.643E-4	1119	0.050	0.040	Q6UXM1.pdb.gz	LRIG3_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 3 OS=Homo sapiens OX=9606 GN=LRIG3 PE=1 SV=1
5	PDB:3o3uN	0.077	0.114	7.782E-4	580	0.020	0.031	3o3uN.pdb.gz	The 1.5 A crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding.
6	PDB:1a8jL	0.072	0.221	1.228E-3	216	0.026	0.106	1a8jL.pdb.gz	Treatment of osteoarthritis with aspartame.
7	PDB:6velC	0.091	0.336	1.542E-3	209	0.019	0.081	6velC.pdb.gz	Regulation of multiple dimeric states of E-cadherin by adhesion activating antibodies revealed through Cryo-EM and X-ray crystallography.
8	AFDB:Q96JA1	0.086	0.071	1.603E-3	1093	0.063	0.051	Q96JA1.pdb.gz	LRIG1_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 1 OS=Homo sapiens OX=9606 GN=LRIG1 PE=1 SV=2
9	PDB:4edqA	0.077	0.129	1.729E-3	483	0.027	0.050	4edqA.pdb.gz	MBP-fusion protein of myosin-binding protein c residues 149-269
10	PDB:4fe9A	0.082	0.147	2.051E-3	446	0.022	0.045	4fe9A.pdb.gz	Multidomain Carbohydrate-binding Proteins Involved in Bacteroides thetaiotaomicron Starch Metabolism.
11	PDB:6jxrm	0.086	0.256	2.727E-3	248	0.034	0.121	6jxrm.pdb.gz
12	PDB:6dldD	0.080	0.228	3.057E-3	269	0.010	0.033	6dldD.pdb.gz
13	AFDB:Q6NY23	0.072	0.079	3.364E-3	807	0.063	0.069	Q6NY23.pdb.gz	Q6NY23_DANRE Kin of IRRE like (Drosophila) OS=Danio rerio OX=7955 GN=kirrel PE=1 SV=1
14	AFDB:A0A0C4DGW3	0.075	0.128	3.770E-3	475	0.092	0.173	A0A0C4DGW3.pdb.gz	A0A0C4DGW3_HUMAN Mucin 1, cell surface associated OS=Homo sapiens OX=9606 GN=MUC1 PE=1 SV=1
15	AFDB:Q924C5	0.076	0.043	4.226E-3	1678	0.153	0.082	Q924C5.pdb.gz	ALPK3_MOUSE Alpha-protein kinase 3 OS=Mus musculus OX=10090 GN=Alpk3 PE=1 SV=2
16	PDB:6feyD	0.091	0.415	4.303E-3	160	0.013	0.075	6feyD.pdb.gz	Structures of insect Imp-L2 suggest an alternative strategy for regulating the bioavailability of insulin-like hormones.
17	PDB:7sqcO0	0.084	0.068	4.555E-3	1140	0.060	0.047	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
18	PDB:6dlfA	0.080	0.266	5.722E-3	236	0.018	0.068	6dlfA.pdb.gz
19	AFDB:D3ZGB1	0.065	0.045	9.937E-3	1548	0.125	0.072	D3ZGB1.pdb.gz	NFAT5_RAT Nuclear factor of activated T-cells 5 OS=Rattus norvegicus OX=10116 GN=Nfat5 PE=1 SV=1
20	AFDB:A4JYL8	0.087	0.145	1.321E-2	475	0.063	0.118	A4JYL8.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A4VAR9	0.0	1288	896	0.768	0.767	A4VAR9_CHICK Dystroglycan 1 OS=Gallus gallus OX=9031 GN=DAG1 PE=2 SV=1
2	F1M8K0	0.0	1548	893	0.926	0.928	F1M8K0_RAT Dystroglycan 1 OS=Rattus norvegicus OX=10116 GN=Dag1 PE=1 SV=1
3	F1QMH7	0.0	903	866	0.590	0.610	F1QMH7_DANRE Dystroglycan 1 OS=Danio rerio OX=7955 GN=dag PE=1 SV=1
4	O18738	0.0	1578	895	0.931	0.931	DAG1_BOVIN Dystroglycan 1 OS=Bos taurus OX=9913 GN=DAG1 PE=1 SV=1
5	Q14118	0.0	1813	895	1.000	1.000	DAG1_HUMAN Dystroglycan 1 OS=Homo sapiens OX=9606 GN=DAG1 PE=1 SV=2
6	Q28685	0.0	1603	895	0.937	0.937	DAG1_RABIT Dystroglycan 1 OS=Oryctolagus cuniculus OX=9986 GN=DAG1 PE=1 SV=1
7	Q62165	0.0	1566	893	0.932	0.934	DAG1_MOUSE Dystroglycan 1 OS=Mus musculus OX=10090 GN=Dag1 PE=1 SV=4
8	Q8JHU7	0.0	903	866	0.590	0.610	Q8JHU7_DANRE Dystroglycan 1 OS=Danio rerio OX=7955 GN=dag PE=1 SV=1
9	C9JEN1	2.36e-86	273	134	0.150	1.000	C9JEN1_HUMAN Dystroglycan 1 (Fragment) OS=Homo sapiens OX=9606 GN=DAG1 PE=1 SV=2
10	C9JYS1	2.59e-74	240	118	0.132	1.000	C9JYS1_HUMAN Dystroglycan 1 (Fragment) OS=Homo sapiens OX=9606 GN=DAG1 PE=1 SV=9
11	C9JQL4	1.49e-73	238	117	0.131	1.000	C9JQL4_HUMAN Dystroglycan 1 (Fragment) OS=Homo sapiens OX=9606 GN=DAG1 PE=1 SV=1
12	Q91XP6	1.48e-66	219	109	0.121	0.991	Q91XP6_RAT Dystroglycan 1 (Fragment) OS=Rattus norvegicus OX=10116 GN=Dag1 PE=2 SV=1
13	Q9GT67	2.47e-44	172	649	0.149	0.205	Q9GT67_DROME Dystroglycan 1 (Fragment) OS=Drosophila melanogaster OX=7227 GN=Dg PE=2 SV=2
14	Q8WR08	9.97e-44	174	1179	0.149	0.113	Q8WR08_DROME Dystroglycan 1 OS=Drosophila melanogaster OX=7227 GN=Dg PE=1 SV=1
15	A0A0C4DHF6	1.09e-43	174	1262	0.149	0.105	A0A0C4DHF6_DROME Dystroglycan 1 OS=Drosophila melanogaster OX=7227 GN=Dg PE=1 SV=1
16	Q8STB9	2.44e-43	172	997	0.149	0.133	Q8STB9_DROME Dystroglycan 1 OS=Drosophila melanogaster OX=7227 GN=Dg PE=1 SV=1
17	Q8WR09	2.80e-43	172	914	0.149	0.146	Q8WR09_DROME Dystroglycan 1 OS=Drosophila melanogaster OX=7227 GN=Dg PE=2 SV=1
18	A1ZA89	2.93e-43	172	914	0.149	0.146	A1ZA89_DROME Dystroglycan 1 OS=Drosophila melanogaster OX=7227 GN=Dg PE=1 SV=1
19	Q91XP7	2.27e-33	125	74	0.069	0.838	Q91XP7_RAT Dystroglycan 1 (Fragment) OS=Rattus norvegicus OX=10116 GN=Dag1 PE=2 SV=1
20	Q8T0G6	3.55e-17	83.2	200	0.079	0.355	Q8T0G6_DROME LD04782p OS=Drosophila melanogaster OX=7227 GN=Dg PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02038 ATP1G1_PLM_MAT8	9.8e+02	10.6	ATP1G1/PLM/MAT8 family
2	PF18424 a_DG1_N2	2.2e-65	229.7	Alpha-Dystroglycan N-terminal domain 2
3	PF05454 DAG1	4.9e-159	539.9	Dystroglycan (Dystrophin-associated glycoprotein 1)
4	PF05345 He_PIG	0.014	27.2	Putative Ig domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000442600

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354923	0.999	Dystrophin
2	9606.ENSP00000356515	0.999	Utrophin
3	9606.ENSP00000363827	0.999	Basement membrane-specific heparan sulfate proteoglycan core protein
4	9606.ENSP00000368678	0.999	Agrin
5	9606.ENSP00000400365	0.999	Laminin subunit alpha-2
6	9606.ENSP00000338343	0.997	Delta-sarcoglycan
7	9606.ENSP00000374309	0.996	Laminin subunit alpha-1
8	9606.ENSP00000298854	0.994	43 kDa receptor-associated protein of the synapse
9	9606.ENSP00000252999	0.993	Laminin subunit alpha-5
10	9606.ENSP00000341940	0.993	Caveolin-3
11	9606.ENSP00000376345	0.991	Growth factor receptor-bound protein 2
12	9606.ENSP00000262018	0.989	Alpha-sarcoglycan
13	9606.ENSP00000341189	0.989	Focal adhesion kinase 1
14	9606.ENSP00000362680	0.989	Proto-oncogene tyrosine-protein kinase Src
15	9606.ENSP00000361302	0.987	Protein O-mannosyl-transferase 1
16	9606.ENSP00000261534	0.986	Protein O-mannosyl-transferase 2
17	9606.ENSP00000361060	0.985	Protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1
18	9606.ENSP00000398930	0.984	Epsilon-sarcoglycan
19	9606.ENSP00000370839	0.981	Beta-sarcoglycan
20	9606.ENSP00000217381	0.976	Alpha-1-syntrophin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043236	0.998	laminin binding
GO:1901681	0.379	sulfur compound binding
GO:0043394	0.367	proteoglycan binding
GO:0043395	0.363	heparan sulfate proteoglycan binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0050793	0.982	regulation of developmental process
GO:0032502	0.975	developmental process
GO:0048856	0.974	anatomical structure development
GO:0050896	0.970	response to stimulus
GO:0032501	0.969	multicellular organismal process
GO:0016043	0.969	cellular component organization
GO:0048522	0.961	positive regulation of cellular process
GO:0051239	0.944	regulation of multicellular organismal process
GO:0051716	0.891	cellular response to stimulus
GO:0045595	0.890	regulation of cell differentiation
GO:0051128	0.878	regulation of cellular component organization
GO:0030154	0.857	cell differentiation
GO:0007154	0.853	cell communication
GO:0023052	0.852	signaling
GO:0048468	0.843	cell development
GO:0044087	0.834	regulation of cellular component biogenesis
GO:0007275	0.811	multicellular organism development
GO:2000026	0.751	regulation of multicellular organismal development
GO:0051240	0.724	positive regulation of multicellular organismal process
GO:0009966	0.709	regulation of signal transduction
GO:0048519	0.699	negative regulation of biological process
GO:0048523	0.690	negative regulation of cellular process
GO:0048513	0.678	animal organ development
GO:0042221	0.676	response to chemical
GO:0051094	0.671	positive regulation of developmental process
GO:0007399	0.657	nervous system development
GO:0009888	0.651	tissue development
GO:0042063	0.651	gliogenesis
GO:0010717	0.633	regulation of epithelial to mesenchymal transition
GO:1903053	0.632	regulation of extracellular matrix organization
GO:0071704	0.611	organic substance metabolic process
GO:0051130	0.606	positive regulation of cellular component organization
GO:0007165	0.506	signal transduction
GO:0044238	0.450	primary metabolic process
GO:0006807	0.406	nitrogen compound metabolic process
GO:0045597	0.367	positive regulation of cell differentiation
GO:0019222	0.346	regulation of metabolic process
GO:1901564	0.314	organonitrogen compound metabolic process
GO:0044237	0.302	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005576	0.997	extracellular region
GO:0032991	0.991	protein-containing complex
GO:0005737	0.897	cytoplasm
GO:0043226	0.896	organelle
GO:0043227	0.888	membrane-bounded organelle
GO:0043229	0.854	intracellular organelle
GO:0005615	0.840	extracellular space
GO:0043231	0.830	intracellular membrane-bounded organelle
GO:0098796	0.624	membrane protein complex
GO:0070013	0.617	intracellular organelle lumen
GO:0090665	0.610	glycoprotein complex
GO:0098797	0.609	plasma membrane protein complex
GO:0031981	0.609	nuclear lumen
GO:0016010	0.593	dystrophin-associated glycoprotein complex
GO:0030054	0.406	cell junction
GO:0005829	0.302	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]