StarFunc result for job id Q14119

User Input

>input (521 residues)
MEANWTAFLFQAHEASHHQQQAAQNSLLPLLSSAVEPPDQKPLLPIPITQKPQGAPETLK
DAIGIKKEKPKTSFVCTYCSKAFRDSYHLRRHESCHTGIKLVSRPKKTPTTVVPLISTIA
GDSSRTSLVSTIAGILSTVTTSSSGTNPSSSASTTAMPVTQSVKKPSKPVKKNHACEMCG
KAFRDVYHLNRHKLSHSDEKPFECPICNQRFKRKDRMTYHVRSHEGGITKPYTCSVCGKG
FSRPDHLSCHVKHVHSTERPFKCQTCTAAFATKDRLRTHMVRHEGKVSCNICGKLLSAAY
ITSHLKTHGQSQSINCNTCKQGISKTCMSEETSNQKQQQQQQQQQQQQQQQQQQHVTSWP
GKQVETLRLWEEAVKARKKEAANLCQTSTAATTPVTLTTPFSITSSVSSGTMSNPVTVAA
AMSMRSPVNVSSAVNITSPMNIGHPVTITSPLSMTSPLTLTTPVNLPTPVTAPVNIAHPV
TITSPMNLPTPMTLAAPLNIAMRPVESMPFLPQALPTSPPW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14119	1.000	1.000	6.473E-89	521	1.000	1.000	Q14119.pdb.gz	VEZF1_HUMAN Vascular endothelial zinc finger 1 OS=Homo sapiens OX=9606 GN=VEZF1 PE=1 SV=2
2	AFDB:Q9NQZ8	0.239	0.253	2.876E-14	489	0.154	0.164	Q9NQZ8.pdb.gz	ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens OX=9606 GN=ZNF71 PE=1 SV=1
3	AFDB:P52742	0.231	0.187	4.374E-14	658	0.148	0.117	P52742.pdb.gz	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
4	AFDB:O75290	0.243	0.202	7.960E-14	641	0.159	0.129	O75290.pdb.gz	Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens OX=9606 GN=ZNF780A PE=1 SV=3
5	AFDB:M9PG92	0.232	0.157	1.211E-13	794	0.200	0.131	M9PG92.pdb.gz	M9PG92_DROME Jim, isoform G OS=Drosophila melanogaster OX=7227 GN=jim PE=4 SV=1
6	AFDB:Q8IZ26	0.237	0.222	1.285E-13	560	0.138	0.129	Q8IZ26.pdb.gz	ZNF34_HUMAN Zinc finger protein 34 OS=Homo sapiens OX=9606 GN=ZNF34 PE=1 SV=3
7	AFDB:Q8NF99	0.253	0.248	1.633E-13	534	0.144	0.140	Q8NF99.pdb.gz	ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens OX=9606 GN=ZNF397 PE=1 SV=2
8	AFDB:O95201	0.292	0.276	1.841E-13	554	0.154	0.144	O95201.pdb.gz	RHIT_HUMAN Transcriptional repressor RHIT OS=Homo sapiens OX=9606 GN=ZNF205 PE=1 SV=2
9	AFDB:Q9R164	0.222	0.173	2.075E-13	701	0.142	0.106	Q9R164.pdb.gz	Q9R164_MOUSE Zinc finger protein 111 OS=Mus musculus OX=10090 GN=Zfp111 PE=2 SV=1
10	AFDB:P21506	0.229	0.209	2.339E-13	573	0.138	0.126	P21506.pdb.gz	ZNF10_HUMAN Zinc finger protein 10 OS=Homo sapiens OX=9606 GN=ZNF10 PE=1 SV=3
11	PDB:3w5kB	0.086	0.266	3.756E-4	110	0.060	0.282	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6ydhA	0.047	0.252	6.697E-1	62	0.019	0.161	6ydhA.pdb.gz
13	PDB:7oniH	0.054	0.067	8.510E-1	380	0.065	0.089	7oniH.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
14	PDB:1e7dA	0.052	0.119	1.644	157	0.027	0.089	1e7dA.pdb.gz	Conformational Flexibility in T4 Endonuclease Vii Revealed by Crystallography: Implications for Substrate Binding and Cleavage
15	PDB:3foqA	0.058	0.066	1.746	439	0.027	0.032	3foqA.pdb.gz	Structure of N-acetylglucosamine-1-phosphate uridyltransferase (GlmU) from Mycobacterium tuberculosis in a cubic space group.
16	PDB:6ff4t	0.046	0.124	1.746	172	0.044	0.134	6ff4t.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
17	PDB:5iv5O	0.056	0.055	1.854	526	0.029	0.029	5iv5O.pdb.gz	Structure of the T4 baseplate and its function in triggering sheath contraction.
18	PDB:7dvqM	0.040	0.089	1.854	191	0.048	0.131	7dvqM.pdb.gz	Structure of the activated human minor spliceosome.
19	PDB:5apny	0.056	0.136	2.090	211	0.058	0.142	5apny.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
20	PDB:2n3dA	0.112	0.390	2.655	103	0.021	0.107	2n3dA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	J3QSH4	0.0	1043	512	0.979	0.996	J3QSH4_HUMAN Vascular endothelial zinc finger 1 OS=Homo sapiens OX=9606 GN=VEZF1 PE=1 SV=1
2	J9JIC7	0.0	680	340	0.639	0.979	J9JIC7_HUMAN Vascular endothelial zinc finger 1 (Fragment) OS=Homo sapiens OX=9606 GN=VEZF1 PE=1 SV=1
3	Q14119	0.0	1070	521	1.000	1.000	VEZF1_HUMAN Vascular endothelial zinc finger 1 OS=Homo sapiens OX=9606 GN=VEZF1 PE=1 SV=2
4	Q5SXC3	0.0	667	336	0.630	0.976	Q5SXC3_MOUSE Vascular endothelial zinc finger 1 (Fragment) OS=Mus musculus OX=10090 GN=Vezf1 PE=1 SV=1
5	Q5SXC4	0.0	1046	518	0.981	0.986	Q5SXC4_MOUSE Vascular endothelial zinc finger 1 OS=Mus musculus OX=10090 GN=Vezf1 PE=1 SV=1
6	Q9Z162	0.0	1047	518	0.983	0.988	Q9Z162_MOUSE Vascular endothelial zinc finger 1 OS=Mus musculus OX=10090 GN=Vezf1 PE=2 SV=1
7	P56671	9.36e-92	290	477	0.274	0.300	MAZ_MOUSE Myc-associated zinc finger protein OS=Mus musculus OX=10090 GN=Maz PE=1 SV=1
8	P56270	9.67e-92	290	477	0.276	0.302	MAZ_HUMAN Myc-associated zinc finger protein OS=Homo sapiens OX=9606 GN=MAZ PE=1 SV=1
9	Q5NBY9	1.55e-71	243	687	0.234	0.178	PATZ1_MOUSE POZ (BTB) and AT hook-containing zinc finger 1 OS=Mus musculus OX=10090 GN=Patz1 PE=1 SV=1
10	Q9HBE1	1.56e-71	243	687	0.234	0.178	PATZ1_HUMAN POZ-, AT hook-, and zinc finger-containing protein 1 OS=Homo sapiens OX=9606 GN=PATZ1 PE=1 SV=1
11	Q9JMG9	1.45e-70	239	641	0.230	0.187	Q9JMG9_MOUSE POZ (BTB) and AT hook containing zinc finger 1 OS=Mus musculus OX=10090 GN=Patz1 PE=1 SV=1
12	P56670	2.04e-48	172	331	0.171	0.269	MAZ_MESAU Myc-associated zinc finger protein (Fragment) OS=Mesocricetus auratus OX=10036 GN=MAZ PE=2 SV=1
13	Q9C0F3	2.76e-28	119	470	0.154	0.170	ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens OX=9606 GN=ZNF436 PE=1 SV=2
14	Q9P2J8	4.94e-27	117	865	0.155	0.094	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3
15	Q8IYN0	9.16e-27	115	542	0.115	0.111	ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens OX=9606 GN=ZNF100 PE=1 SV=2
16	Q8K2R5	1.18e-26	116	619	0.169	0.142	ZN668_MOUSE Zinc finger protein 668 OS=Mus musculus OX=10090 GN=Znf668 PE=2 SV=1
17	Q8BGV5	1.45e-26	115	572	0.127	0.115	ZNF8_MOUSE Zinc finger protein 8 OS=Mus musculus OX=10090 GN=Znf8 PE=1 SV=1
18	Q6NX49	1.65e-26	116	715	0.163	0.119	ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens OX=9606 GN=ZNF544 PE=1 SV=1
19	Q8WXB4	1.68e-26	116	792	0.159	0.105	ZN606_HUMAN Zinc finger protein 606 OS=Homo sapiens OX=9606 GN=ZNF606 PE=2 SV=1
20	Q96K58	3.07e-26	115	619	0.152	0.128	ZN668_HUMAN Zinc finger protein 668 OS=Homo sapiens OX=9606 GN=ZNF668 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01722 BolA	8.4e+02	11.7	BolA-like protein
2	PF12326 EOS1	1.6e+02	13.7	N-glycosylation protein
3	PF12090 Spt20	2.9e+02	12.5	Spt20 family
4	PF14746 WASH-7_C	9.7e+02	10.9	WASH complex subunit 7, C-terminal
5	PF00096 zf-C2H2	5.9e-13	59.6	Zinc finger, C2H2 type
6	PF13894 zf-C2H2_4	5.1e-15	65.9	C2H2-type zinc finger
7	PF13912 zf-C2H2_6	3.6	19.0	C2H2-type zinc finger
8	PF12171 zf-C2H2_jaz	3.4	19.3	Zinc-finger double-stranded RNA-binding
9	PF13465 zf-H2C2_2	4.7e-11	53.8	Zinc-finger double domain
10	PF18508 zf_C2H2_13	5.5e+02	11.6	Zinc finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000462337

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000272233	0.848	Rho-related GTP-binding protein RhoB
2	9606.ENSP00000331310	0.765	Mortality factor 4-like protein 1
3	9606.ENSP00000412461	0.745	Rho GTPase-activating protein 22
4	9606.ENSP00000357000	0.715	Upstream stimulatory factor 1
5	9606.ENSP00000360372	0.649	Cytochrome P450 2C19
6	9606.ENSP00000352438	0.598	Poly(rC)-binding protein 2
7	9606.ENSP00000333275	0.591	Nuclear receptor subfamily 2 group C member 1
8	9606.ENSP00000358576	0.579	5' exonuclease Apollo
9	9606.ENSP00000362170	0.571	Nuclear apoptosis-inducing factor 1
10	9606.ENSP00000353820	0.547	Cytochrome P450 2D6
11	9606.ENSP00000360522	0.544	Retinol-binding protein 4
12	9606.ENSP00000420405	0.537	Fibrinogen silencer-binding protein
13	9606.ENSP00000263377	0.536	Bromodomain-containing protein 4
14	9606.ENSP00000299290	0.513	Protein TBATA
15	9606.ENSP00000337915	0.510	Cytochrome P450 3A4
16	9606.ENSP00000301921	0.509	Transcription factor SOX-7
17	9606.ENSP00000355114	0.509	DDB1- and CUL4-associated factor 12
18	9606.ENSP00000263736	0.502	S1 RNA-binding domain-containing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0001228	1.000	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000977	1.000	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0030855	0.983	epithelial cell differentiation
GO:0001568	0.981	blood vessel development
GO:0003158	0.980	endothelium development
GO:0050789	0.969	regulation of biological process
GO:0050794	0.961	regulation of cellular process
GO:0045446	0.946	endothelial cell differentiation
GO:0048514	0.925	blood vessel morphogenesis
GO:0001885	0.924	endothelial cell development
GO:0001525	0.913	angiogenesis
GO:0031323	0.903	regulation of cellular metabolic process
GO:0051171	0.885	regulation of nitrogen compound metabolic process
GO:0080090	0.882	regulation of primary metabolic process
GO:0060255	0.880	regulation of macromolecule metabolic process
GO:0019219	0.862	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.846	regulation of macromolecule biosynthetic process
GO:0031326	0.846	regulation of cellular biosynthetic process
GO:0010468	0.842	regulation of gene expression
GO:0048518	0.772	positive regulation of biological process
GO:0051252	0.719	regulation of RNA metabolic process
GO:0006355	0.707	regulation of DNA-templated transcription
GO:0048522	0.677	positive regulation of cellular process
GO:0010604	0.625	positive regulation of macromolecule metabolic process
GO:0051173	0.618	positive regulation of nitrogen compound metabolic process
GO:0050896	0.605	response to stimulus
GO:0031325	0.600	positive regulation of cellular metabolic process
GO:0006357	0.381	regulation of transcription by RNA polymerase II
GO:0048519	0.360	negative regulation of biological process
GO:0045935	0.351	positive regulation of nucleobase-containing compound metabolic process
GO:0048523	0.313	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.356	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]