StarFunc result for job id Q14123

User Input

>input (709 residues)
MESPTKEIEEFESNSLKYLQPEQIEKIWLRLRGLRKYKKTSQRLRSLVKQLERGEASVVD
LKKNLEYAATVLESVYIDETRRLLDTEDELSDIQSDAVPSEVRDWLASTFTRQMGMMLRR
SDEKPRFKSIVHAVQAGIFVERMYRRTSNMVGLSYPPAVIEALKDVDKWSFDVFSLNEAS
GDHALKFIFYELLTRYDLISRFKIPISALVSFVEALEVGYSKHKNPYHNLMHAADVTQTV
HYLLYKTGVANWLTELEIFAIIFSAAIHDYEHTGTTNNFHIQTRSDPAILYNDRSVLENH
HLSAAYRLLQDDEEMNILINLSKDDWREFRTLVIEMVMATDMSCHFQQIKAMKTALQQPE
AIEKPKALSLMLHTADISHPAKAWDLHHRWTMSLLEEFFRQGDREAELGLPFSPLCDRKS
TMVAQSQVGFIDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKR
SGVKTSGSEGSAPINNSVISVDYKSFKATWTEVVHINRERWRAKVPKEEKAKKEAEEKAR
LAAEEQQKEMEAKSQAEEGASGKAEKKTSGETKNQVNGTRANKSDNPRGKNSKAEKSSGE
QQQNGDFKDGKNKTDKKDHSNIGNDSKKTDGTKQRSHGSPAPSTSSTCRLTLPVIKPPLR
HFKRPAYASSSYAPSVSKKTDEHPARYKMLDQRIKMKKIQNISHNWNRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q63421	0.582	0.539	5.230E-70	768	0.896	0.827	Q63421.pdb.gz	PDE1C_RAT Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1C OS=Rattus norvegicus OX=10116 GN=Pde1c PE=1 SV=1
2	AFDB:E7F6Z8	0.525	0.605	4.085E-51	611	0.546	0.633	E7F6Z8.pdb.gz	E7F6Z8_DANRE Phosphodiesterase OS=Danio rerio OX=7955 GN=pde1a PE=3 SV=3
3	AFDB:Q61481	0.524	0.675	4.225E-46	545	0.513	0.668	Q61481.pdb.gz	PDE1A_MOUSE Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A OS=Mus musculus OX=10090 GN=Pde1a PE=1 SV=3
4	AFDB:Q01064	0.469	0.618	3.372E-39	536	0.433	0.573	Q01064.pdb.gz	PDE1B_HUMAN Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B OS=Homo sapiens OX=9606 GN=PDE1B PE=1 SV=2
5	AFDB:O18696	0.502	0.534	2.015E-37	664	0.358	0.383	O18696.pdb.gz	PDE1_CAEEL Probable 3',5'-cyclic phosphodiesterase pde-1 OS=Caenorhabditis elegans OX=6239 GN=pde-1 PE=1 SV=2
6	AFDB:B7YZV4	0.472	0.404	2.813E-33	834	0.347	0.295	B7YZV4.pdb.gz	PDE1_DROME Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1 OS=Drosophila melanogaster OX=7227 GN=Pde1c PE=1 SV=1
7	AFDB:Q63085	0.425	0.276	1.870E-19	1108	0.181	0.116	Q63085.pdb.gz	PDE3B_RAT cGMP-inhibited 3',5'-cyclic phosphodiesterase 3B OS=Rattus norvegicus OX=10116 GN=Pde3b PE=1 SV=1
8	AFDB:Q57V52	0.397	0.416	2.314E-19	676	0.186	0.195	Q57V52.pdb.gz	Q57V52_TRYB2 Phosphodiesterase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.3K10.420 PE=3 SV=1
9	AFDB:O60658	0.395	0.339	2.624E-18	829	0.145	0.124	O60658.pdb.gz	PDE8A_HUMAN High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A OS=Homo sapiens OX=9606 GN=PDE8A PE=1 SV=2
10	AFDB:O88502	0.386	0.334	3.247E-18	823	0.152	0.131	O88502.pdb.gz	PDE8A_MOUSE High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A OS=Mus musculus OX=10090 GN=Pde8a PE=1 SV=1
11	PDB:4y86B	0.384	0.814	9.042E-18	326	0.126	0.273	4y86B.pdb.gz	Structural Asymmetry of Phosphodiesterase-9A and a Unique Pocket for Selective Binding of a Potent Enantiomeric Inhibitor.
12	PDB:7jsnA	0.357	0.311	3.223E-13	820	0.144	0.124	7jsnA.pdb.gz	Structure of the Visual Signaling Complex between Transducin and Phosphodiesterase 6.
13	PDB:6mzbB	0.413	0.364	1.929E-12	807	0.123	0.108	6mzbB.pdb.gz	Cryo-EM structure of phosphodiesterase 6 reveals insights into the allosteric regulation of type I phosphodiesterases.
14	PDB:3bjcA	0.346	0.755	1.427E-10	311	0.109	0.248	3bjcA.pdb.gz	An insight into the pharmacophores of phosphodiesterase-5 inhibitors from synthetic and crystal structural studies
15	PDB:6kswA	0.113	0.135	6.792E-1	513	0.066	0.092	6kswA.pdb.gz
16	PDB:6pbzA	0.132	0.183	7.718E-1	485	0.041	0.060	6pbzA.pdb.gz
17	PDB:6lthL	0.103	0.135	8.054E-1	466	0.056	0.086	6lthL.pdb.gz	Structure of nucleosome-bound human BAF complex.
18	PDB:7cz5R	0.096	0.189	8.771E-1	269	0.031	0.082	7cz5R.pdb.gz	Structural basis for activation of the growth hormone-releasing hormone receptor.
19	PDB:7f3tA	0.073	0.116	8.771E-1	330	0.068	0.145	7f3tA.pdb.gz	TMEM120A contains a specific coenzyme A-binding site and might not mediate poking- or stretch-induced channel activities in cells.
20	PDB:6bgjA	0.076	0.100	9.153E-1	490	0.056	0.082	6bgjA.pdb.gz	Cryo-EM structures of the TMEM16A calcium-activated chloride channel.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JZX9	664	465	0.444	0.677	A0A0G2JZX9_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde1a PE=3 SV=2
2	A0A0G2K2K1	726	515	0.491	0.676	A0A0G2K2K1_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde1a PE=3 SV=2
3	A0A2R8RXK7	773	587	0.515	0.622	A0A2R8RXK7_DANRE Phosphodiesterase OS=Danio rerio OX=7955 GN=pde1a PE=3 SV=1
4	A0A8I5Y792	685	515	0.484	0.666	A0A8I5Y792_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde1a PE=3 SV=1
5	A0A8I5Y879	728	508	0.485	0.677	A0A8I5Y879_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde1a PE=3 SV=1
6	A0A8I6A416	751	542	0.515	0.673	A0A8I6A416_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde1a PE=3 SV=1
7	A0A8I6A5M3	728	526	0.492	0.663	A0A8I6A5M3_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde1a PE=3 SV=1
8	A0A8I6GJQ6	666	508	0.450	0.628	A0A8I6GJQ6_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde1a PE=3 SV=1
9	E7F6Z8	813	611	0.544	0.632	E7F6Z8_DANRE Phosphodiesterase OS=Danio rerio OX=7955 GN=pde1a PE=3 SV=3
10	P14100	761	530	0.499	0.668	PDE1A_BOVIN Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A OS=Bos taurus OX=9913 GN=PDE1A PE=1 SV=3
11	P54750	769	535	0.522	0.692	PDE1A_HUMAN Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A OS=Homo sapiens OX=9606 GN=PDE1A PE=1 SV=2
12	Q01061	632	534	0.434	0.577	PDE1B_BOVIN Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B OS=Bos taurus OX=9913 GN=PDE1B PE=1 SV=1
13	Q01064	647	536	0.447	0.591	PDE1B_HUMAN Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B OS=Homo sapiens OX=9606 GN=PDE1B PE=1 SV=2
14	Q01065	642	535	0.436	0.578	PDE1B_MOUSE Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B OS=Mus musculus OX=10090 GN=Pde1b PE=1 SV=2
15	Q01066	642	535	0.434	0.576	PDE1B_RAT Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B OS=Rattus norvegicus OX=10116 GN=Pde1b PE=1 SV=1
16	Q14123	1477	709	1.000	1.000	PDE1C_HUMAN Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1C OS=Homo sapiens OX=9606 GN=PDE1C PE=1 SV=1
17	Q61481	750	545	0.511	0.664	PDE1A_MOUSE Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A OS=Mus musculus OX=10090 GN=Pde1a PE=1 SV=3
18	Q63421	1277	768	0.896	0.827	PDE1C_RAT Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1C OS=Rattus norvegicus OX=10116 GN=Pde1c PE=1 SV=1
19	Q64338	1350	706	0.946	0.950	PDE1C_MOUSE Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1C OS=Mus musculus OX=10090 GN=Pde1c PE=1 SV=2
20	Q64395	642	535	0.434	0.576	PDE1B_CRIGR Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B OS=Cricetulus griseus OX=10029 GN=PDE1B1 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00233 PDEase_I	4.1e-80	280.5	3'5'-cyclic nucleotide phosphodiesterase
2	PF08499 PDEase_I_N	2.6e-29	112.2	3'5'-cyclic nucleotide phosphodiesterase N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000019798

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000013221	0.917	Adenylosuccinate lyase
2	9601.ENSPPYP00000014514	0.915	Phosphodiesterase
3	9601.ENSPPYP00000005255	0.909	Phosphodiesterase 1B, calmodulin-dependent
4	9601.ENSPPYP00000006891	0.903	Pongo abelii calmodulin 1 (phosphorylase kinase, delta) (CALM1), mRNA
5	9601.ENSPPYP00000020982	0.903	Belongs to the calmodulin family.
6	9601.ENSPPYP00000019048	0.902	Ectonucleotide pyrophosphatase/phosphodiesterase 1
7	9601.ENSPPYP00000008627	0.900	Adenine phosphoribosyltransferase
8	9601.ENSPPYP00000016543	0.900	Deoxycytidine kinase
9	9601.ENSPPYP00000021553	0.900	Involved in maintaining the homeostasis of cellular nucleotides by catalyzing the interconversion of nucleoside phosphates. Has GTP:AMP phosphotransferase and ITP:AMP phosphotransferase activities
10	9601.ENSPPYP00000021082	0.841	May be involved in the calcium-dependent regulation of rhodopsin phosphorylation. Binds three calcium ions (By similarity).
11	9601.ENSPPYP00000007853	0.807	Guanine nucleotide-binding protein subunit gamma
12	9601.ENSPPYP00000004790	0.804	G protein subunit beta 3
13	9601.ENSPPYP00000020019	0.803	Guanine nucleotide binding protein, alpha transducing 3
14	9601.ENSPPYP00000016926	0.770	Guanylate cyclase 1, soluble, beta 3
15	9601.ENSPPYP00000011357	0.768	Calmodulin 3 (phosphorylase kinase, delta)
16	9601.ENSPPYP00000013880	0.768	annotation not available
17	9601.ENSPPYP00000008288	0.754	Adenylate cyclase 7
18	9601.ENSPPYP00000002306	0.745	Calmodulin-like 6
19	9601.ENSPPYP00000002382	0.745	Calmodulin-like 5
20	9601.ENSPPYP00000002383	0.745	Belongs to the calmodulin family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0047555	1.000	3',5'-cyclic-GMP phosphodiesterase activity
GO:0004115	1.000	3',5'-cyclic-AMP phosphodiesterase activity
GO:0005488	0.997	binding
GO:0005515	0.840	protein binding
GO:0048101	0.810	calmodulin-activated 3',5'-cyclic-GMP phosphodiesterase activity
GO:0043167	0.795	ion binding
GO:0097159	0.588	organic cyclic compound binding
GO:0004117	0.567	calmodulin-activated dual specificity 3',5'-cyclic-GMP, 3',5'-cyclic-AMP phosphodiesterase activity
GO:1901363	0.558	heterocyclic compound binding
GO:0036094	0.381	small molecule binding
GO:0000166	0.374	nucleotide binding
GO:0097367	0.365	carbohydrate derivative binding
GO:0043168	0.363	anion binding
GO:0032555	0.359	purine ribonucleotide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0003008	0.981	system process
GO:0050877	0.891	nervous system process
GO:0009987	0.836	cellular process
GO:0065007	0.652	biological regulation
GO:0050794	0.638	regulation of cellular process
GO:0050896	0.574	response to stimulus
GO:0007600	0.479	sensory perception
GO:0051716	0.477	cellular response to stimulus
GO:0008152	0.444	metabolic process
GO:0071704	0.417	organic substance metabolic process
GO:0007154	0.403	cell communication
GO:0023052	0.383	signaling
GO:0007608	0.383	sensory perception of smell
GO:0006807	0.380	nitrogen compound metabolic process
GO:0044237	0.372	cellular metabolic process
GO:1901564	0.371	organonitrogen compound metabolic process
GO:0006753	0.361	nucleoside phosphate metabolic process
GO:0007165	0.352	signal transduction
GO:0009117	0.303	nucleotide metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.992	cytosol
GO:0043231	0.989	intracellular membrane-bounded organelle
GO:0005634	0.668	nucleus
GO:0036477	0.540	somatodendritic compartment
GO:0044297	0.463	cell body
GO:0043025	0.433	neuronal cell body
GO:0016020	0.328	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:25277	1.000	3',5'-cyclic AMP + H2O = AMP + H(+)
RHEA:16957	1.000	3',5'-cyclic GMP + H2O = GMP + H(+)
EC:3.1.4.53	1.000	3',5'-cyclic-AMP phosphodiesterase.
EC:3.1.4.35	1.000	3',5'-cyclic-GMP phosphodiesterase.

[back to server]