StarFunc result for job id Q14126

User Input

>input (1118 residues)
MARSPGRAYALLLLLICFNVGSGLHLQVLSTRNENKLLPKHPHLVRQKRAWITAPVALRE
GEDLSKKNPIAKIHSDLAEERGLKITYKYTGKGITEPPFGIFVFNKDTGELNVTSILDRE
ETPFFLLTGYALDARGNNVEKPLELRIKVLDINDNEPVFTQDVFVGSVEELSAAHTLVMK
INATDADEPNTLNSKISYRIVSLEPAYPPVFYLNKDTGEIYTTSVTLDREEHSSYTLTVE
ARDGNGEVTDKPVKQAQVQIRILDVNDNIPVVENKVLEGMVEENQVNVEVTRIKVFDADE
IGSDNWLANFTFASGNEGGYFHIETDAQTNEGIVTLIKEVDYEEMKNLDFSVIVANKAAF
HKSIRSKYKPTPIPIKVKVKNVKEGIHFKSSVISIYVSESMDRSSKGQIIGNFQAFDEDT
GLPAHARYVKLEDRDNWISVDSVTSEIKLAKLPDFESRYVQNGTYTVKIVAISEDYPRKT
ITGTVLINVEDINDNCPTLIEPVQTICHDAEYVNVTAEDLDGHPNSGPFSFSVIDKPPGM
AEKWKIARQESTSVLLQQSEKKLGRSEIQFLISDNQGFSCPEKQVLTLTVCECLHGSGCR
EAQHDSYVGLGPAAIALMILAFLLLLLVPLLLLMCHCGKGAKGFTPIPGTIEMLHPWNNE
GAPPEDKVVPSFLPVDQGGSLVGRNGVGGMAKEATMKGSSSASIVKGQHEMSEMDGRWEE
HRSLLSGRATQFTGATGAIMTTETTKTARATGASRDMAGAQAAAVALNEEFLRNYFTDKA
ASYTEEDENHTAKDCLLVYSQEETESLNASIGCCSFIEGELDDRFLDDLGLKFKTLAEVC
LGQKIDINKEIEQRQKPATETSMNTASHSLCEQTMVNSENTYSSGSSFPVPKSLQEANAE
KVTQEIVTERSVSSRQAQKVATPLPDPMASRNVIATETSYVTGSTMPPTTVILGPSQPQS
LIVTERVYAPASTLVDQPYANEGTVVVTERVIQPHGGGSNPLEGTQHLQDVPYVMVRERE
SFLAPSSGVQPTLAMPNIAVGQNVTVTERVLAPASTLQSSYQIPTENSMTARNTTVSGAG
VPGPLPDFGLEESGHSNSTITTSSTRVTKHSTVQHSYS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1LYX9	0.527	0.523	0.000	1128	0.755	0.748	F1LYX9.pdb.gz	F1LYX9_RAT Desmoglein 2 OS=Rattus norvegicus OX=10116 GN=Dsg2 PE=1 SV=2
2	AFDB:O55111	0.502	0.500	0.000	1122	0.764	0.761	O55111.pdb.gz	DSG2_MOUSE Desmoglein-2 OS=Mus musculus OX=10090 GN=Dsg2 PE=1 SV=3
3	AFDB:Q14126	0.999	0.999	0.000	1118	1.000	1.000	Q14126.pdb.gz	DSG2_HUMAN Desmoglein-2 OS=Homo sapiens OX=9606 GN=DSG2 PE=1 SV=2
4	AFDB:O35902	0.417	0.466	2.736E-84	993	0.335	0.377	O35902.pdb.gz	DSG3_MOUSE Desmoglein-3 OS=Mus musculus OX=10090 GN=Dsg3 PE=2 SV=1
5	AFDB:Q86SJ6	0.450	0.482	7.340E-84	1040	0.339	0.364	Q86SJ6.pdb.gz	DSG4_HUMAN Desmoglein-4 OS=Homo sapiens OX=9606 GN=DSG4 PE=1 SV=1
6	AFDB:Q7TMD7	0.452	0.484	1.968E-82	1041	0.324	0.348	Q7TMD7.pdb.gz	DSG4_MOUSE Desmoglein-4 OS=Mus musculus OX=10090 GN=Dsg4 PE=1 SV=1
7	AFDB:P55283	0.376	0.448	8.623E-70	916	0.214	0.261	P55283.pdb.gz	CADH4_HUMAN Cadherin-4 OS=Homo sapiens OX=9606 GN=CDH4 PE=2 SV=2
8	AFDB:Q4U1I6	0.426	0.500	2.443E-68	933	0.218	0.262	Q4U1I6.pdb.gz
9	AFDB:Q90275	0.379	0.463	2.188E-66	893	0.208	0.261	Q90275.pdb.gz	CADH2_DANRE Cadherin-2 OS=Danio rerio OX=7955 GN=cdh2 PE=1 SV=2
10	AFDB:P15116	0.363	0.439	5.258E-65	906	0.217	0.268	P15116.pdb.gz	CADH2_MOUSE Cadherin-2 OS=Mus musculus OX=10090 GN=Cdh2 PE=1 SV=2
11	PDB:6velC	0.180	0.920	3.510E-22	209	0.077	0.411	6velC.pdb.gz	Regulation of multiple dimeric states of E-cadherin by adhesion activating antibodies revealed through Cryo-EM and X-ray crystallography.
12	PDB:7sqcO0	0.132	0.130	7.973E-15	1140	0.040	0.039	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
13	PDB:4aq1A	0.108	0.149	1.916E-12	721	0.072	0.111	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
14	PDB:5oj2B	0.087	0.129	2.023E-11	692	0.067	0.108	5oj2B.pdb.gz
15	PDB:1e07A	0.090	0.124	2.968E-9	642	0.052	0.090	1e07A.pdb.gz
16	PDB:7sqcO1	0.117	0.170	1.047E-7	673	0.036	0.059	7sqcO1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
17	PDB:6dldD	0.105	0.285	1.377E-7	269	0.042	0.175	6dldD.pdb.gz
18	PDB:5a42A	0.088	0.071	1.623E-7	1597	0.059	0.041	5a42A.pdb.gz
19	PDB:7nycA	0.083	0.066	1.623E-7	1542	0.058	0.042	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
20	PDB:4lnvB	0.075	0.077	4.600E-7	1063	0.060	0.063	4lnvB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6AG90	0.0	1563	1131	0.742	0.733	A0A8I6AG90_RAT Desmoglein 2 OS=Rattus norvegicus OX=10116 GN=Dsg2 PE=1 SV=1
2	F1LYX9	0.0	1593	1128	0.757	0.750	F1LYX9_RAT Desmoglein 2 OS=Rattus norvegicus OX=10116 GN=Dsg2 PE=1 SV=2
3	O35902	0.0	577	993	0.333	0.375	DSG3_MOUSE Desmoglein-3 OS=Mus musculus OX=10090 GN=Dsg3 PE=2 SV=1
4	O55111	0.0	1679	1122	0.767	0.764	DSG2_MOUSE Desmoglein-2 OS=Mus musculus OX=10090 GN=Dsg2 PE=1 SV=3
5	P32926	0.0	579	999	0.349	0.390	DSG3_HUMAN Desmoglein-3 OS=Homo sapiens OX=9606 GN=DSG3 PE=1 SV=2
6	Q14126	0.0	2315	1118	1.000	1.000	DSG2_HUMAN Desmoglein-2 OS=Homo sapiens OX=9606 GN=DSG2 PE=1 SV=2
7	Q6W3B0	0.0	577	1040	0.336	0.362	DSG4_RAT Desmoglein-4 OS=Rattus norvegicus OX=10116 GN=Dsg4 PE=1 SV=1
8	Q7TMD7	0.0	580	1041	0.335	0.360	DSG4_MOUSE Desmoglein-4 OS=Mus musculus OX=10090 GN=Dsg4 PE=1 SV=1
9	Q86SJ6	0.0	593	1040	0.344	0.370	DSG4_HUMAN Desmoglein-4 OS=Homo sapiens OX=9606 GN=DSG4 PE=1 SV=1
10	Q02413	5.29e-172	536	1049	0.336	0.358	DSG1_HUMAN Desmoglein-1 OS=Homo sapiens OX=9606 GN=DSG1 PE=1 SV=2
11	H2EQR6	6.50e-144	464	1142	0.294	0.288	DSG21_DANRE Desmoglein-2.1 OS=Danio rerio OX=7955 GN=dsg2.1 PE=2 SV=1
12	Q03763	1.04e-121	402	1043	0.196	0.210	DSG1_BOVIN Desmoglein-1 OS=Bos taurus OX=9913 GN=DSG1 PE=1 SV=1
13	Q61495	5.51e-118	392	1057	0.194	0.205	DSG1A_MOUSE Desmoglein-1-alpha OS=Mus musculus OX=10090 GN=Dsg1a PE=2 SV=2
14	Q7TSF1	8.80e-118	392	1060	0.194	0.205	DSG1B_MOUSE Desmoglein-1-beta OS=Mus musculus OX=10090 GN=Dsg1b PE=1 SV=1
15	D3ZM39	9.97e-115	383	1060	0.188	0.198	D3ZM39_RAT Desmoglein 1 OS=Rattus norvegicus OX=10116 GN=Dsg1 PE=4 SV=1
16	Q7TSF0	1.05e-111	371	911	0.190	0.233	DSG1C_MOUSE Desmoglein-1-gamma OS=Mus musculus OX=10090 GN=Dsg1c PE=1 SV=1
17	P55292	1.32e-99	338	902	0.226	0.280	DSC2_MOUSE Desmocollin-2 OS=Mus musculus OX=10090 GN=Dsc2 PE=1 SV=1
18	Q90275	8.27e-95	325	893	0.179	0.224	CADH2_DANRE Cadherin-2 OS=Danio rerio OX=7955 GN=cdh2 PE=1 SV=2
19	P55850	9.31e-95	325	896	0.217	0.271	DSC3_MOUSE Desmocollin-3 OS=Mus musculus OX=10090 GN=Dsc3 PE=1 SV=3
20	Q14574	1.28e-94	324	896	0.213	0.266	DSC3_HUMAN Desmocollin-3 OS=Homo sapiens OX=9606 GN=DSC3 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00028 Cadherin	9.9e-48	171.9	Cadherin domain
2	PF08266 Cadherin_2	4.3e+02	12.2	Cadherin-like
3	PF16184 Cadherin_3	1.4	20.2	Cadherin-like
4	PF01049 CADH_Y-type_LIR	24	16.5	Cadherin, Y-type LIR-motif
5	PF18957 RibLong	1.6e+02	14.5	Long Rib domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261590

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377508	0.994	Junction plakoglobin
2	9606.ENSP00000070846	0.981	Plakophilin-2
3	9606.ENSP00000369129	0.976	Desmoplakin
4	9606.ENSP00000339191	0.974	Caveolin-1
5	9606.ENSP00000331678	0.940	Plakophilin-3
6	9606.ENSP00000263946	0.935	Plakophilin-1
7	9606.ENSP00000280904	0.932	Desmocollin-2
8	9606.ENSP00000311032	0.912	Caspase-3
9	9606.ENSP00000374409	0.858	Plakophilin-4
10	9606.ENSP00000397157	0.847	P53 apoptosis effector related to PMP-22
11	9606.ENSP00000344456	0.837	Catenin beta-1
12	9606.ENSP00000303992	0.761	Transmembrane protein 43
13	9606.ENSP00000257198	0.760	Desmocollin-1
14	9606.ENSP00000353608	0.714	Desmocollin-3
15	9606.ENSP00000362680	0.690	Proto-oncogene tyrosine-protein kinase Src
16	9606.ENSP00000357789	0.683	Filaggrin
17	9606.ENSP00000410257	0.679	Sodium channel protein type 5 subunit alpha
18	9606.ENSP00000313875	0.662	Membrane cofactor protein
19	9606.ENSP00000238682	0.651	Transforming growth factor beta-3
20	9606.ENSP00000382004	0.649	Catenin delta-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0098632	0.995	cell-cell adhesion mediator activity
GO:0086080	0.542	protein binding involved in heterotypic cell-cell adhesion
GO:0086083	0.528	cell adhesive protein binding involved in bundle of His cell-Purkinje myocyte communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050794	0.972	regulation of cellular process
GO:0032501	0.942	multicellular organismal process
GO:0007155	0.920	cell adhesion
GO:0048856	0.911	anatomical structure development
GO:1903522	0.819	regulation of blood circulation
GO:0008016	0.798	regulation of heart contraction
GO:0032970	0.774	regulation of actin filament-based process
GO:0071840	0.772	cellular component organization or biogenesis
GO:0007154	0.744	cell communication
GO:0016043	0.735	cellular component organization
GO:0006937	0.733	regulation of muscle contraction
GO:0065008	0.708	regulation of biological quality
GO:0050896	0.682	response to stimulus
GO:1903115	0.680	regulation of actin filament-based movement
GO:0061337	0.668	cardiac conduction
GO:0086065	0.557	cell communication involved in cardiac conduction
GO:0006942	0.551	regulation of striated muscle contraction
GO:0055117	0.502	regulation of cardiac muscle contraction
GO:0034330	0.492	cell junction organization
GO:0009888	0.402	tissue development
GO:0042391	0.401	regulation of membrane potential
GO:0007275	0.363	multicellular organism development
GO:0045216	0.358	cell-cell junction organization
GO:0048518	0.339	positive regulation of biological process
GO:0044085	0.319	cellular component biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0030054	0.998	cell junction
GO:0005911	0.994	cell-cell junction
GO:0043227	0.981	membrane-bounded organelle
GO:0005737	0.976	cytoplasm
GO:0005576	0.929	extracellular region
GO:0030057	0.921	desmosome
GO:0043229	0.906	intracellular organelle
GO:0001533	0.883	cornified envelope
GO:0043231	0.833	intracellular membrane-bounded organelle
GO:0031982	0.831	vesicle
GO:0005615	0.827	extracellular space
GO:0065010	0.815	extracellular membrane-bounded organelle
GO:1903561	0.814	extracellular vesicle
GO:0070062	0.708	extracellular exosome
GO:0005829	0.436	cytosol
GO:0012505	0.371	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]