StarFunc result for job id Q14134

User Input

>input (588 residues)
MEAADASRSNGSSPEARDARSPSGPSGSLENGTKADGKDAKTTNGHGGEAAEGKSLGSAL
KPGEGRSALFAGNEWRRPIIQFVESGDDKNSNYFSMDSMEGKRSPYAGLQLGAAKKPPVT
FAEKGELRKSIFSESRKPTVSIMEPGETRRNSYPRADTGLFSRSKSGSEEVLCDSCIGNK
QKAVKSCLVCQASFCELHLKPHLEGAAFRDHQLLEPIRDFEARKCPVHGKTMELFCQTDQ
TCICYLCMFQEHKNHSTVTVEEAKAEKETELSLQKEQLQLKIIEIEDEAEKWQKEKDRIK
SFTTNEKAILEQNFRDLVRDLEKQKEEVRAALEQREQDAVDQVKVIMDALDERAKVLHED
KQTREQLHSISDSVLFLQEFGALMSNYSLPPPLPTYHVLLEGEGLGQSLGNFKDDLLNVC
MRHVEKMCKADLSRNFIERNHMENGGDHRYVNNYTNSFGGEWSAPDTMKRYSMYLTPKGG
VRTSYQPSSPGRFTKETTQKNFNNLYGTKGNYTSRVWEYSSSIQNSDNDLPVVQGSSSFS
LKGYPSLMRSQSPKAQPQTWKSGKQTMLSHYRPFYVNKGNGIGSNEAP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14134	1.000	1.000	1.249E-88	588	1.000	1.000	Q14134.pdb.gz	TRI29_HUMAN Tripartite motif-containing protein 29 OS=Homo sapiens OX=9606 GN=TRIM29 PE=1 SV=2
2	AFDB:Q8R2Q0	0.496	0.497	4.064E-74	587	0.895	0.896	Q8R2Q0.pdb.gz	TRI29_MOUSE Tripartite motif-containing protein 29 OS=Mus musculus OX=10090 GN=Trim29 PE=1 SV=1
3	AFDB:H0Y626	0.297	0.197	9.001E-19	953	0.202	0.125	H0Y626.pdb.gz	H0Y626_HUMAN B box-type domain-containing protein OS=Homo sapiens OX=9606 PE=4 SV=2
4	AFDB:B3DFR8	0.292	0.316	2.334E-18	532	0.145	0.160	B3DFR8.pdb.gz
5	AFDB:A2BFT4	0.315	0.321	3.641E-18	573	0.158	0.162	A2BFT4.pdb.gz
6	AFDB:Q61510	0.387	0.361	8.316E-18	634	0.150	0.139	Q61510.pdb.gz	TRI25_MOUSE E3 ubiquitin/ISG15 ligase TRIM25 OS=Mus musculus OX=10090 GN=Trim25 PE=1 SV=2
7	AFDB:Q96LD4	0.257	0.243	1.673E-17	638	0.141	0.130	Q96LD4.pdb.gz	TRI47_HUMAN E3 ubiquitin-protein ligase TRIM47 OS=Homo sapiens OX=9606 GN=TRIM47 PE=1 SV=2
8	AFDB:F1QZK7	0.315	0.283	2.024E-17	664	0.133	0.117	F1QZK7.pdb.gz
9	AFDB:Q14258	0.394	0.371	1.993E-16	630	0.145	0.135	Q14258.pdb.gz	TRI25_HUMAN E3 ubiquitin/ISG15 ligase TRIM25 OS=Homo sapiens OX=9606 GN=TRIM25 PE=1 SV=2
10	AFDB:B0S648	0.328	0.373	2.738E-16	505	0.128	0.149	B0S648.pdb.gz
11	PDB:7z36B	0.204	0.250	3.094E-5	446	0.061	0.081	7z36B.pdb.gz	Structure and functional mapping of the KRAB-KAP1 repressor complex.
12	PDB:4tn3B	0.230	0.346	4.529E-5	362	0.077	0.124	4tn3B.pdb.gz	Structural studies of postentry restriction factors reveal antiparallel dimers that enable avid binding to the HIV-1 capsid lattice.
13	PDB:7y4sA	0.181	0.278	6.230E-1	343	0.046	0.079	7y4sA.pdb.gz
14	PDB:4h63H	0.063	0.197	7.074E-1	174	0.043	0.144	4h63H.pdb.gz
15	PDB:5n9jG	0.063	0.183	9.120E-1	163	0.044	0.160	5n9jG.pdb.gz
16	PDB:4v60A	0.110	0.082	3.249	812	0.063	0.046	4v60A.pdb.gz
17	PDB:5n9jU	0.069	0.189	4.190	198	0.039	0.116	5n9jU.pdb.gz
18	PDB:6hivCR	0.048	0.081	5.069	314	0.032	0.061	6hivCR.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
19	PDB:6o76B	0.056	0.070	5.402	451	0.017	0.022	6o76B.pdb.gz
20	PDB:2hh7A	0.044	0.289	6.134	85	0.015	0.106	2hh7A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q0P6H7	0.0	931	446	0.752	0.991	Q0P6H7_HUMAN TRIM29 protein OS=Homo sapiens OX=9606 GN=TRIM29 PE=1 SV=2
2	Q14134	0.0	1231	588	1.000	1.000	TRI29_HUMAN Tripartite motif-containing protein 29 OS=Homo sapiens OX=9606 GN=TRIM29 PE=1 SV=2
3	Q8R2Q0	0.0	1095	587	0.895	0.896	TRI29_MOUSE Tripartite motif-containing protein 29 OS=Mus musculus OX=10090 GN=Trim29 PE=1 SV=1
4	Q08CC1	1.99e-40	157	573	0.160	0.164	Q08CC1_DANRE FinTRIM family, member 82 OS=Danio rerio OX=7955 GN=si:dkey-252h13.6 PE=1 SV=1
5	Q99PP9	2.57e-38	150	556	0.133	0.140	TRI16_MOUSE Tripartite motif-containing protein 16 OS=Mus musculus OX=10090 GN=Trim16 PE=1 SV=2
6	Q7ZVQ7	1.04e-28	123	654	0.114	0.102	Q7ZVQ7_DANRE E3 ubiquitin/ISG15 ligase TRIM25 OS=Danio rerio OX=7955 GN=zgc:55773 PE=1 SV=1
7	A0A2R8QTG3	1.68e-28	122	645	0.114	0.104	A0A2R8QTG3_DANRE E3 ubiquitin/ISG15 ligase TRIM25 isoform X1 OS=Danio rerio OX=7955 GN=zgc:55773 PE=1 SV=1
8	A0A0R4IUT0	2.16e-28	121	544	0.117	0.127	A0A0R4IUT0_DANRE Bloodthirsty-related gene family, member 20 OS=Danio rerio OX=7955 GN=btr20 PE=4 SV=1
9	O95361	7.16e-28	120	564	0.119	0.124	TRI16_HUMAN Tripartite motif-containing protein 16 OS=Homo sapiens OX=9606 GN=TRIM16 PE=1 SV=3
10	H0Y626	1.50e-27	120	953	0.119	0.073	H0Y626_HUMAN B box-type domain-containing protein OS=Homo sapiens OX=9606 PE=4 SV=2
11	Q61510	1.38e-24	110	634	0.134	0.125	TRI25_MOUSE E3 ubiquitin/ISG15 ligase TRIM25 OS=Mus musculus OX=10090 GN=Trim25 PE=1 SV=2
12	Q14258	1.28e-23	107	630	0.129	0.121	TRI25_HUMAN E3 ubiquitin/ISG15 ligase TRIM25 OS=Homo sapiens OX=9606 GN=TRIM25 PE=1 SV=2
13	Q6P7B3	2.43e-23	106	643	0.126	0.115	Q6P7B3_RAT Tripartite motif-containing 25 OS=Rattus norvegicus OX=10116 GN=Trim25 PE=2 SV=1
14	D4A9N5	2.68e-23	106	643	0.126	0.115	D4A9N5_RAT Tripartite motif-containing 25 OS=Rattus norvegicus OX=10116 GN=Trim25 PE=1 SV=3
15	Q96LD4	2.67e-22	103	638	0.109	0.100	TRI47_HUMAN E3 ubiquitin-protein ligase TRIM47 OS=Homo sapiens OX=9606 GN=TRIM47 PE=1 SV=2
16	Q8C0E3	4.67e-22	102	641	0.095	0.087	TRI47_MOUSE E3 ubiquitin-protein ligase TRIM47 OS=Mus musculus OX=10090 GN=Trim47 PE=1 SV=2
17	Q8BGE7	8.28e-13	73.2	488	0.128	0.154	TRIM6_MOUSE Tripartite motif-containing protein 6 OS=Mus musculus OX=10090 GN=Trim6 PE=1 SV=1
18	Q9C030	3.63e-12	71.2	488	0.128	0.154	TRIM6_HUMAN Tripartite motif-containing protein 6 OS=Homo sapiens OX=9606 GN=TRIM6 PE=1 SV=1
19	Q587N6	6.97e-11	67.0	495	0.094	0.111	TRIM5_MACFA Tripartite motif-containing protein 5 OS=Macaca fascicularis OX=9541 GN=TRIM5 PE=2 SV=1
20	F1QYX5	7.21e-11	67.4	582	0.087	0.088	F1QYX5_DANRE Bloodthirsty-related gene family, member 1 OS=Danio rerio OX=7955 GN=btr01 PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08202 MIS13	78	14.0	Mis12-Mtw1 protein family
2	PF00643 zf-B_box	2.7e-06	38.8	B-box zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000343129

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000269305	0.939	Cellular tumor antigen p53
2	9606.ENSP00000304229	0.918	Histidine triad nucleotide-binding protein 1
3	9606.ENSP00000005340	0.844	Segment polarity protein dishevelled homolog DVL-2
4	9606.ENSP00000252242	0.745	Keratin, type II cytoskeletal 5
5	9606.ENSP00000301263	0.684	Lymphocyte antigen 6D
6	9606.ENSP00000295756	0.681	T-cell receptor-associated transmembrane adapter 1
7	9606.ENSP00000308452	0.663	Keratin, type I cytoskeletal 17
8	9606.ENSP00000231524	0.639	E3 ubiquitin-protein ligase TRIM23
9	9606.ENSP00000356426	0.598	TGF-beta-activated kinase 1 and MAP3K7-binding protein 2
10	9606.ENSP00000263182	0.586	Gamma-butyrobetaine dioxygenase
11	9606.ENSP00000418960	0.583	Breast cancer type 1 susceptibility protein
12	9606.ENSP00000301653	0.575	Keratin, type I cytoskeletal 16
13	9606.ENSP00000362578	0.575	E3 ubiquitin-protein ligase RNF8
14	9606.ENSP00000365924	0.568	E3 ubiquitin-protein ligase TRIM31
15	9606.ENSP00000483825	0.554	NF-kappa-B essential modulator
16	9606.ENSP00000354791	0.550	Dynactin subunit 1
17	9606.ENSP00000340507	0.546	Transcription intermediary factor 1-alpha
18	9606.ENSP00000284240	0.540	Thy-1 membrane glycoprotein
19	9606.ENSP00000311219	0.531	Tripartite motif-containing protein 59
20	9606.ENSP00000372221	0.531	Serpin B5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	0.997	identical protein binding
GO:0098631	0.993	cell adhesion mediator activity
GO:0098632	0.982	cell-cell adhesion mediator activity
GO:0045296	0.894	cadherin binding
GO:1901363	0.441	heterocyclic compound binding
GO:0097159	0.441	organic cyclic compound binding
GO:0003824	0.388	catalytic activity
GO:0098641	0.335	cadherin binding involved in cell-cell adhesion
GO:0002039	0.318	p53 binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.985	regulation of cellular process
GO:0048519	0.972	negative regulation of biological process
GO:0060255	0.958	regulation of macromolecule metabolic process
GO:0051171	0.943	regulation of nitrogen compound metabolic process
GO:0080090	0.942	regulation of primary metabolic process
GO:0031323	0.934	regulation of cellular metabolic process
GO:0010468	0.921	regulation of gene expression
GO:0048523	0.917	negative regulation of cellular process
GO:0006355	0.899	regulation of DNA-templated transcription
GO:1900180	0.871	regulation of protein localization to nucleus
GO:0010605	0.868	negative regulation of macromolecule metabolic process
GO:0045892	0.853	negative regulation of DNA-templated transcription
GO:1903828	0.847	negative regulation of protein localization
GO:0006357	0.768	regulation of transcription by RNA polymerase II
GO:0000122	0.748	negative regulation of transcription by RNA polymerase II
GO:1900181	0.671	negative regulation of protein localization to nucleus
GO:0009987	0.601	cellular process
GO:0050896	0.508	response to stimulus
GO:0048518	0.398	positive regulation of biological process
GO:0008152	0.371	metabolic process
GO:0071704	0.337	organic substance metabolic process
GO:0048583	0.318	regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.996	cytoplasm
GO:0030054	0.629	cell junction
GO:0070161	0.527	anchoring junction
GO:0005911	0.500	cell-cell junction
GO:0005829	0.487	cytosol
GO:0005912	0.459	adherens junction
GO:0043229	0.457	intracellular organelle
GO:0005634	0.355	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]