StarFunc result for job id Q14135

User Input

>input (290 residues)
METPLDVLSRAASLVHADDEKREAALRGEPRMQTLPVASALSSHRTGPPPISPSKRKFSM
EPGDEDLDCDNDHVSKMSRIFNPHLNKTANGDCRRDPRERSRSPIERAVAPTMSLHGSHL
YTSLPSLGLEQPLALTKNSLDASRPAGLSPTLTPGERQQNRPSVITCASAGARNCNLSHC
PIAHSGCAAPGPASYRRPPSAATTCDPVVEEHFRRSLGKNYKEPEPAPNSVSITGSVDDH
FAKALGDTWLQIKAAKDGASSSPESASRRGQPASPSAHMVSHSHSPSVVS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14135	1.000	1.000	3.966E-43	290	1.000	1.000	Q14135.pdb.gz	VGLL4_HUMAN Transcription cofactor vestigial-like protein 4 OS=Homo sapiens OX=9606 GN=VGLL4 PE=1 SV=4
2	AFDB:Q80V24	0.327	0.329	2.532E-31	287	0.821	0.829	Q80V24.pdb.gz	VGLL4_MOUSE Transcription cofactor vestigial-like protein 4 OS=Mus musculus OX=10090 GN=Vgll4 PE=1 SV=1
3	AFDB:Q6NV03	0.202	0.205	4.179E-24	282	0.634	0.652	Q6NV03.pdb.gz	Q6NV03_DANRE Transcription cofactor vestigial-like protein 4 OS=Danio rerio OX=7955 GN=vgll4 PE=2 SV=1
4	AFDB:Q9V426	0.090	0.063	3.626E-1	490	0.152	0.090	Q9V426.pdb.gz	Q9V426_DROME LD07162p OS=Drosophila melanogaster OX=7227 GN=vig PE=1 SV=1
5	AFDB:A0A024R7R0	0.094	0.045	3.879E-1	719	0.141	0.057	A0A024R7R0.pdb.gz
6	AFDB:A0A0B4KGR6	0.081	0.035	3.879E-1	1113	0.186	0.049	A0A0B4KGR6.pdb.gz	A0A0B4KGR6_DROME Myosin heavy chain-like, isoform I OS=Drosophila melanogaster OX=7227 GN=Mhcl PE=4 SV=1
7	AFDB:O60057	0.068	0.052	8.696E-1	411	0.172	0.122	O60057.pdb.gz	MU147_SCHPO Meiotically up-regulated gene 147 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug147 PE=1 SV=1
8	AFDB:Q6K1E7	0.108	0.089	1.393	370	0.141	0.111	Q6K1E7.pdb.gz	GGNB1_MOUSE Gametogenetin-binding protein 1 OS=Mus musculus OX=10090 GN=Ggnbp1 PE=1 SV=2
9	AFDB:A3KNJ6	0.080	0.075	1.593	307	0.141	0.134	A3KNJ6.pdb.gz	A3KNJ6_DANRE Homeo box B1b OS=Danio rerio OX=7955 GN=cb249 PE=2 SV=1
10	AFDB:Q0KI85	0.094	0.032	1.593	1087	0.131	0.035	Q0KI85.pdb.gz	Q0KI85_DROME Sidestep VI, isoform B OS=Drosophila melanogaster OX=7227 GN=side-VI PE=1 SV=1
11	PDB:2jaoA	0.074	0.107	7.123	196	0.017	0.026	2jaoA.pdb.gz	Crystal Structures of Human and Murine Deoxyribonucleotidases: Insights Into Recognition of Substrates and Nucleotide Analogues.
12	PDB:7aoaD	0.060	0.052	7.618	343	0.024	0.020	7aoaD.pdb.gz	The topology of chromatin-binding domains in the NuRD deacetylase complex.
13	PDB:2i7dA	0.074	0.108	8.715	193	0.017	0.026	2i7dA.pdb.gz	Structures of Human and Murine cytosolic deoxyribonucleotidase: Insights into substrate specificity and catalysis

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14135	0.0	586	290	1.000	1.000	VGLL4_HUMAN Transcription cofactor vestigial-like protein 4 OS=Homo sapiens OX=9606 GN=VGLL4 PE=1 SV=4
2	Q80V24	1.01e-155	437	287	0.779	0.787	VGLL4_MOUSE Transcription cofactor vestigial-like protein 4 OS=Mus musculus OX=10090 GN=Vgll4 PE=1 SV=1
3	Q6NV03	1.66e-121	350	282	0.631	0.649	Q6NV03_DANRE Transcription cofactor vestigial-like protein 4 OS=Danio rerio OX=7955 GN=vgll4 PE=2 SV=1
4	Q1RLU0	3.97e-14	72.8	266	0.179	0.195	Q1RLU0_DANRE Vestigial-like 4 like OS=Danio rerio OX=7955 GN=sb:cb747 PE=2 SV=2
5	Q8IQJ9	0.064	37.0	382	0.045	0.034	Q8IQJ9_DROME RE45537p OS=Drosophila melanogaster OX=7227 GN=Tgi PE=2 SV=1
6	Q9VU85	0.10	36.6	535	0.045	0.024	Q9VU85_DROME Tondu-domain-containing growth inhibitor, isoform A OS=Drosophila melanogaster OX=7227 GN=Tgi PE=4 SV=1
7	Q9LV03	0.41	34.7	2208	0.100	0.013	GLUT1_ARATH Glutamate synthase 1 [NADH], chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GLT1 PE=1 SV=2
8	Q0JKD0	0.44	34.7	2167	0.093	0.012	GLT1_ORYSJ Glutamate synthase 1 [NADH], chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0681900 PE=2 SV=1
9	Q9CAD6	0.85	33.5	523	0.076	0.042	C86A7_ARATH Cytochrome P450 86A7 OS=Arabidopsis thaliana OX=3702 GN=CYP86A7 PE=2 SV=1
10	Q7SZP3	2.1	32.3	380	0.069	0.053	Q7SZP3_DANRE Homeobox protein Meis1 OS=Danio rerio OX=7955 GN=meis4.1a PE=1 SV=1
11	Q9PTM7	3.0	31.6	393	0.059	0.043	Q9PTM7_DANRE Meis homeobox 2b OS=Danio rerio OX=7955 GN=meis2.1 PE=1 SV=1
12	Q9VT91	3.0	32.0	942	0.097	0.030	Q9VT91_DROME Cannonball OS=Drosophila melanogaster OX=7227 GN=can PE=2 SV=1
13	Q9DDE0	9.2	30.4	393	0.059	0.043	Q9DDE0_DANRE Meis homeobox 2a OS=Danio rerio OX=7955 GN=meis2.1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15245 VGLL4	2.2e-89	310.9	Transcription cofactor vestigial-like protein 4
2	PF07545 Vg_Tdu	1.7	19.9	Vestigial/Tondu family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9544.ENSMMUP00000028720

Rank	PPI partner	STRING score	Description
1	9544.ENSMMUP00000014816	0.951	TEA domain family member 4
2	9544.ENSMMUP00000014250	0.931	TEA domain family member 1 (SV40 transcriptional enhancer factor)
3	9544.ENSMMUP00000026660	0.917	Uncharacterized protein
4	9544.ENSMMUP00000020914	0.803	Transcriptional enhancer factor TEF-5
5	9544.ENSMMUP00000019413	0.777	TEA domain transcription factor 2
6	9544.ENSMMUP00000012987	0.752	Probable E3 ubiquitin protein ligase involved in the proteasome-mediated ubiquitin-dependent degradation of target proteins. Through the degradation of CTNNB1, functions downstream of FOXF2 to negatively regulate the Wnt signaling pathway. Probably plays a role in the development of the central nervous system and in neuronal maintenance (By similarity). Also acts as a transcriptional regulator of genes controlling female reproductive function. May play a role in gene transcription by transactivating GNRH1 promoter and repressing PENK promoter (By similarity)
7	9544.ENSMMUP00000031270	0.689	Vestigial-like family member 2
8	9544.ENSMMUP00000002878	0.688	Proto-oncogene with serine/threonine kinase activity involved in cell survival and cell proliferation.
9	9544.ENSMMUP00000000704	0.683	Vestigial-like family member 3
10	9544.ENSMMUP00000008502	0.669	Uncharacterized protein
11	9544.ENSMMUP00000038848	0.656	Apoptotic protease-activating factor 1
12	9544.ENSMMUP00000025857	0.643	Interferon regulatory factor 2-binding protein 1
13	9544.ENSMMUP00000003929	0.589	Ataxin 1
14	9544.ENSMMUP00000012865	0.529	Large tumor suppressor kinase 1
15	9544.ENSMMUP00000022787	0.508	Proto-oncogene with serine/threonine kinase activity involved in cell survival and cell proliferation.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.980	regulation of cellular process
GO:0035330	0.901	regulation of hippo signaling
GO:0048519	0.879	negative regulation of biological process
GO:0040008	0.841	regulation of growth
GO:0048523	0.815	negative regulation of cellular process
GO:0035331	0.800	negative regulation of hippo signaling
GO:0030111	0.655	regulation of Wnt signaling pathway
GO:0045926	0.597	negative regulation of growth
GO:0001558	0.526	regulation of cell growth
GO:0032502	0.426	developmental process
GO:0019222	0.317	regulation of metabolic process
GO:0019219	0.311	regulation of nucleobase-containing compound metabolic process
GO:0060255	0.307	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]