StarFunc result for job id Q14137

User Input

>input (746 residues)
MAGSRGAGRTAAPSVRPEKRRSEPELEPEPEPEPPLLCTSPLSHSTGSDSGVSDSEESVF
SGLEDSGSDSSEDDDEGDEEGEDGALDDEGHSGIKKTTEEQVQASTPCPRTEMASARIGD
EYAEDSSDEEDIRNTVGNVPLEWYDDFPHVGYDLDGRRIYKPLRTRDELDQFLDKMDDPD
YWRTVQDPMTGRDLRLTDEQVALVRRLQSGQFGDVGFNPYEPAVDFFSGDVMIHPVTNRP
ADKRSFIPSLVEKEKVSRMVHAIKMGWIQPRRPRDPTPSFYDLWAQEDPNAVLGRHKMHV
PAPKLALPGHAESYNPPPEYLLSEEERLAWEQQEPGERKLSFLPRKFPSLRAVPAYGRFI
QERFERCLDLYLCPRQRKMRVNVDPEDLIPKLPRPRDLQPFPTCQALVYRGHSDLVRCLS
VSPGGQWLVSGSDDGSLRLWEVATARCVRTVPVGGVVKSVAWNPSPAVCLVAAAVEDSVL
LLNPALGDRLVAGSTDQLLSAFVPPEEPPLQPARWLEASEEERQVGLRLRICHGKPVTQV
TWHGRGDYLAVVLATQGHTQVLIHQLSRRRSQSPFRRSHGQVQRVAFHPARPFLLVASQR
SVRLYHLLRQELTKKLMPNCKWVSSLAVHPAGDNVICGSYDSKLVWFDLDLSTKPYRMLR
HHKKALRAVAFHPRYPLFASGSDDGSVIVCHGMVYNDLLQNPLLVPVKVLKGHVLTRDLG
VLDVIFHPTQPWVFSSGADGTVRLFT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14137	1.000	1.000	0.000	746	1.000	1.000	Q14137.pdb.gz	BOP1_HUMAN Ribosome biogenesis protein BOP1 OS=Homo sapiens OX=9606 GN=BOP1 PE=1 SV=2
2	AFDB:Q04660	0.611	0.566	3.692E-76	807	0.397	0.367	Q04660.pdb.gz	ERB1_YEAST Ribosome biogenesis protein ERB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ERB1 PE=1 SV=1
3	PDB:7nacm	0.606	0.677	4.774E-69	666	0.365	0.408	7nacm.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
4	PDB:6elzm	0.596	0.687	3.653E-66	645	0.362	0.419	6elzm.pdb.gz	Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.
5	AFDB:A0A075B729	0.157	0.495	4.862E-27	217	0.291	1.000	A0A075B729.pdb.gz	A0A075B729_HUMAN BOP1 ribosomal biogenesis factor (Fragment) OS=Homo sapiens OX=9606 GN=BOP1 PE=1 SV=1
6	PDB:3jcmB	0.352	0.598	2.124E-19	429	0.066	0.114	3jcmB.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
7	PDB:2h9lA	0.349	0.774	3.128E-19	321	0.084	0.196	2h9lA.pdb.gz
8	PDB:5mzhB	0.328	0.555	3.693E-19	415	0.078	0.140	5mzhB.pdb.gz
9	PDB:7mq8LU	0.349	0.567	4.126E-19	445	0.099	0.166	7mq8LU.pdb.gz	Nucleolar maturation of the human small subunit processome.
10	PDB:6tblF	0.353	0.748	6.788E-19	336	0.072	0.161	6tblF.pdb.gz
11	PDB:7d5sB2	0.350	0.308	1.319E-18	851	0.079	0.069	7d5sB2.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
12	PDB:7bt6x	0.320	0.466	2.053E-18	488	0.109	0.166	7bt6x.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
13	AFDB:O48847	0.345	0.328	2.301E-18	787	0.146	0.139	O48847.pdb.gz	LUH_ARATH Transcriptional corepressor LEUNIG_HOMOLOG OS=Arabidopsis thaliana OX=3702 GN=LUH PE=1 SV=1
14	PDB:3dm0A	0.345	0.379	2.707E-18	675	0.084	0.093	3dm0A.pdb.gz	Structure of a signal transduction regulator, RACK1, from Arabidopsis thaliana.
15	AFDB:O88466	0.337	0.138	7.943E-17	1888	0.150	0.059	O88466.pdb.gz	ZN106_MOUSE Zinc finger protein 106 OS=Mus musculus OX=10090 GN=Znf106 PE=1 SV=3
16	AFDB:Q9C0J8	0.352	0.202	8.471E-14	1336	0.097	0.054	Q9C0J8.pdb.gz	WDR33_HUMAN pre-mRNA 3' end processing protein WDR33 OS=Homo sapiens OX=9606 GN=WDR33 PE=1 SV=2
17	AFDB:A0A140VK66	0.300	0.217	2.217E-12	1066	0.161	0.113	A0A140VK66.pdb.gz	A0A140VK66_HUMAN Testicular secretory protein Li 66 OS=Homo sapiens OX=9606 PE=2 SV=1
18	AFDB:D6W4T8	0.205	0.136	1.232E-11	1266	0.118	0.070	D6W4T8.pdb.gz	D6W4T8_DROME Coronin OS=Drosophila melanogaster OX=7227 GN=pod1 PE=1 SV=1
19	AFDB:Q921C3	0.319	0.112	1.538E-11	2304	0.070	0.023	Q921C3.pdb.gz	BRWD1_MOUSE Bromodomain and WD repeat-containing protein 1 OS=Mus musculus OX=10090 GN=Brwd1 PE=1 SV=2
20	AFDB:O43379	0.233	0.126	3.558E-8	1518	0.066	0.032	O43379.pdb.gz	WDR62_HUMAN WD repeat-containing protein 62 OS=Homo sapiens OX=9606 GN=WDR62 PE=1 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F4IH25	0.0	555	753	0.385	0.381	BOP1_ARATH Ribosome biogenesis protein BOP1 homolog OS=Arabidopsis thaliana OX=3702 GN=BOP1 PE=1 SV=1
2	P97452	0.0	1215	732	0.826	0.842	BOP1_MOUSE Ribosome biogenesis protein BOP1 OS=Mus musculus OX=10090 GN=Bop1 PE=1 SV=1
3	Q04660	0.0	543	807	0.367	0.340	ERB1_YEAST Ribosome biogenesis protein ERB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ERB1 PE=1 SV=1
4	Q14137	0.0	1521	746	1.000	1.000	BOP1_HUMAN Ribosome biogenesis protein BOP1 OS=Homo sapiens OX=9606 GN=BOP1 PE=1 SV=2
5	Q7K0Y1	0.0	739	784	0.460	0.438	BOP1_DROME Ribosome biogenesis protein BOP1 homolog OS=Drosophila melanogaster OX=7227 GN=CG5033 PE=2 SV=1
6	O74399	2.02e-174	520	740	0.374	0.377	ERB1_SCHPO Ribosome biogenesis protein erb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=erb1 PE=1 SV=2
7	A0A075B729	8.21e-130	385	217	0.248	0.853	A0A075B729_HUMAN BOP1 ribosomal biogenesis factor (Fragment) OS=Homo sapiens OX=9606 GN=BOP1 PE=1 SV=1
8	Q384Z1	4.65e-126	396	781	0.335	0.320	Q384Z1_TRYB2 Ribosome biogenesis protein BOP1 homolog OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.4620 PE=3 SV=1
9	D6QUQ2	1.31e-10	66.6	463	0.097	0.156	D6QUQ2_9CNID Poc1 OS=Clytia hemisphaerica OX=252671 PE=2 SV=1
10	A2CEH0	1.63e-09	63.2	490	0.098	0.149	POC1B_DANRE POC1 centriolar protein homolog B OS=Danio rerio OX=7955 GN=poc1b PE=2 SV=1
11	P70483	1.80e-09	63.5	780	0.095	0.091	STRN_RAT Striatin OS=Rattus norvegicus OX=10116 GN=Strn PE=1 SV=1
12	P58405	6.23e-09	62.0	794	0.106	0.099	STRN3_RAT Striatin-3 OS=Rattus norvegicus OX=10116 GN=Strn3 PE=1 SV=2
13	Q9VU65	8.18e-09	60.8	391	0.095	0.182	POC1_DROME POC1 centriolar protein homolog OS=Drosophila melanogaster OX=7227 GN=Poc1 PE=2 SV=1
14	M9NEC0	1.45e-08	60.8	747	0.098	0.098	M9NEC0_DROME Connector of kinase to AP-1, isoform F OS=Drosophila melanogaster OX=7227 GN=Cka PE=1 SV=1
15	Q86M30	1.46e-08	60.5	730	0.098	0.100	Q86M30_DROME WD-40 family member protein OS=Drosophila melanogaster OX=7227 GN=Cka PE=2 SV=1
16	Q9VLT9	1.56e-08	60.5	730	0.098	0.100	Q9VLT9_DROME Connector of kinase to AP-1, isoform A OS=Drosophila melanogaster OX=7227 GN=Cka PE=1 SV=2
17	D3DML3	1.64e-08	60.5	749	0.098	0.097	D3DML3_DROME Connector of kinase to AP-1, isoform E OS=Drosophila melanogaster OX=7227 GN=Cka PE=1 SV=1
18	M9PF42	1.68e-08	60.5	722	0.098	0.101	M9PF42_DROME Connector of kinase to AP-1, isoform G OS=Drosophila melanogaster OX=7227 GN=Cka PE=1 SV=1
19	Q8TC44	1.86e-08	60.1	478	0.094	0.146	POC1B_HUMAN POC1 centriolar protein homolog B OS=Homo sapiens OX=9606 GN=POC1B PE=1 SV=1
20	O43815	1.90e-08	60.5	780	0.092	0.088	STRN_HUMAN Striatin OS=Homo sapiens OX=9606 GN=STRN PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	0.00018	33.1	Anaphase-promoting complex subunit 4 WD40 domain
2	PF08145 BOP1NT	6.5e-106	365.6	BOP1NT (NUC169) domain
3	PF04053 Coatomer_WDAD	4.1e+02	11.4	Coatomer WD associated region
4	PF11237 DUF3038	3.1e+02	12.8	Protein of unknown function (DUF3038)
5	PF20426 NBCH_WD40	0.029	24.8	Neurobeachin beta propeller domain
6	PF00400 WD40	5.1e-29	111.1	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000455106

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000221801	0.999	rRNA 2'-O-methyltransferase fibrillarin
2	9606.ENSP00000261015	0.999	Ribosome biogenesis protein WDR12
3	9606.ENSP00000264279	0.999	Nucleolar protein 58
4	9606.ENSP00000346725	0.999	Pescadillo homolog
5	9606.ENSP00000370589	0.999	Nucleolar protein 56
6	9606.ENSP00000395772	0.999	Guanine nucleotide-binding protein-like 3
7	9606.ENSP00000407323	0.999	Probable rRNA-processing protein EBP2
8	9606.ENSP00000355541	0.998	HEAT repeat-containing protein 1
9	9606.ENSP00000364320	0.998	mRNA turnover protein 4 homolog
10	9606.ENSP00000383949	0.998	NHP2-like protein 1
11	9606.ENSP00000432119	0.998	WD repeat-containing protein 74
12	9606.ENSP00000254940	0.996	60S ribosome subunit biogenesis protein NIP7 homolog
13	9606.ENSP00000350698	0.996	Probable ATP-dependent RNA helicase DDX47
14	9606.ENSP00000308179	0.995	WD repeat-containing protein 3
15	9606.ENSP00000317992	0.995	Nucleolar complex protein 2 homolog
16	9606.ENSP00000354040	0.995	Nucleolar GTP-binding protein 1
17	9606.ENSP00000358812	0.995	Protein RRP5 homolog
18	9606.ENSP00000371858	0.995	Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase
19	9606.ENSP00000225298	0.994	U3 small nucleolar RNA-associated protein 18 homolog
20	9606.ENSP00000247003	0.994	Probable ATP-dependent RNA helicase DDX49

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.996	cellular metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:0043170	0.995	macromolecule metabolic process
GO:0044238	0.991	primary metabolic process
GO:0042254	0.985	ribosome biogenesis
GO:0034470	0.982	ncRNA processing
GO:0006364	0.957	rRNA processing
GO:0042273	0.923	ribosomal large subunit biogenesis
GO:0050789	0.888	regulation of biological process
GO:0050794	0.867	regulation of cellular process
GO:0000470	0.719	maturation of LSU-rRNA
GO:0000463	0.669	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005730	1.000	nucleolus
GO:0005654	0.998	nucleoplasm
GO:0032991	0.990	protein-containing complex
GO:1990904	0.895	ribonucleoprotein complex
GO:0140513	0.713	nuclear protein-containing complex
GO:0005737	0.630	cytoplasm
GO:0005694	0.367	chromosome
GO:0030684	0.356	preribosome
GO:0030686	0.318	90S preribosome
GO:0070545	0.302	PeBoW complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]