StarFunc result for job id Q14139

User Input

>input (1066 residues)
MTDQENNNNISSNPFAALFGSLADAKQFAAIQKEQLKQQSDELPASPDDSDNSVSESLDE
FDYSVAEISRSFRSQQEICEQLNINHMIQRIFLITLDNSDPSLKSGNGIPSRCVYLEEMA
VELEDQDWLDMSNVEQALFARLLLQDPGNHLINMTSSTTLNLSADRDAGERHIFCYLYSC
FQRAKEEITKVPENLLPFAVQCRNLTVSNTRTVLLTPEIYVDQNIHEQLVDLMLEAIQGA
HFEDVTEFLEEVIEALILDEEVRTFPEVMIPVFDILLGRIKDLELCQILLYAYLDILLYF
TRQKDMAKVFVEYIQPKDPTNGQMYQKTLLGVILSISCLLKTPGVVENHGYFLNPSRSSP
QEIKVQEANIHQFMAQFHEKIYQMLKNLLQLSPETKHCILSWLGNCLHANAGRTKIWANQ
MPEIFFQMYASDAFFLNLGAALLKLCQPFCKPRSSRLLTFNPTYCALKELNDEERKIKNV
HMRGLDKETCLIPAVQEPKFPQNYNLVTENLALTEYTLYLGFHRLHDQMVKINQNLHRLQ
VAWRDAQQSSSPAADNLREQFERLMTIYLSTKTAMTEPQMLQNCLNLQVSMAVLLVQLAI
GNEGSQPIELTFPLPDGYSSLAYVPEFFADNLGDFLIFLRRFADDILETSADSLEHVLHF
ITIFTGSIERMKNPHLRAKLAEVLEAVMPHLDQTPNPLVSSVFHRKRVFCNFQYAPQLAE
ALIKVFVDIEFTGDPHQFEQKFNYRRPMYPILRYMWGTDTYRESIKDLADYASKNLEAMN
PPLFLRFLNLLMNDAIFLLDEAIQYLSKIKIQQIEKDRGEWDSLTPEARREKEAGLQMFG
QLARFHNIMSNETIGTLAFLTSEIKSLFVHPFLAERIISMLNYFLQHLVGPKMGALKVKD
FSEFDFKPQQLVSDICTIYLNLGDEENFCATVPKDGRSYSPTLFAQTVRVLKKINKPGNM
IMAFSNLAERIKSLADLQQQEEETYADACDEFLDPIMSTLMCDPVVLPSSRVTVDRSTIA
RHLLSDQTDPFNRSPLTMDQIRPNTELKEKIQRWLAERKQQKEQLE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9Q735	0.666	0.690	0.000	1028	0.935	0.970	E9Q735.pdb.gz	UBE4A_MOUSE Ubiquitin conjugation factor E4 A OS=Mus musculus OX=10090 GN=Ube4a PE=1 SV=1
2	AFDB:Q14139	1.000	1.000	0.000	1066	1.000	1.000	Q14139.pdb.gz	UBE4A_HUMAN Ubiquitin conjugation factor E4 A OS=Homo sapiens OX=9606 GN=UBE4A PE=1 SV=2
3	AFDB:Q9LF41	0.740	0.759	2.391E-41	1038	0.265	0.273	Q9LF41.pdb.gz	UBE4_ARATH Probable ubiquitin conjugation factor E4 OS=Arabidopsis thaliana OX=3702 GN=PUB1 PE=2 SV=1
4	AFDB:Q9HE05	0.751	0.790	1.085E-39	1010	0.255	0.269	Q9HE05.pdb.gz	UFD2_SCHPO Ubiquitin conjugation factor E4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ufd2 PE=2 SV=1
5	AFDB:O44007	0.712	0.698	3.649E-39	1089	0.272	0.266	O44007.pdb.gz	O44007_DICDI NOSA OS=Dictyostelium discoideum OX=44689 GN=nosA PE=2 SV=1
6	AFDB:F1M8V2	0.732	0.670	4.903E-36	1173	0.247	0.224	F1M8V2.pdb.gz	F1M8V2_RAT Ubiquitin conjugation factor E4 OS=Rattus norvegicus OX=10116 GN=Ube4b PE=1 SV=3
7	AFDB:O95155	0.698	0.578	5.429E-34	1302	0.234	0.191	O95155.pdb.gz	UBE4B_HUMAN Ubiquitin conjugation factor E4 B OS=Homo sapiens OX=9606 GN=UBE4B PE=1 SV=1
8	AFDB:P54860	0.741	0.815	1.148E-33	961	0.227	0.252	P54860.pdb.gz	UFD2_YEAST E4 ubiquitin-protein ligase UFD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UFD2 PE=1 SV=3
9	PDB:3m62A	0.696	0.769	3.669E-31	955	0.222	0.248	3m62A.pdb.gz
10	AFDB:Q09349	0.725	0.780	5.484E-31	984	0.220	0.238	Q09349.pdb.gz	UBE4_CAEEL Ubiquitin conjugation factor E4 ufd-2 OS=Caenorhabditis elegans OX=6239 GN=ufd-2 PE=1 SV=2
11	AFDB:Q5XPI4	0.531	0.442	2.226E-13	1314	0.124	0.100	Q5XPI4.pdb.gz	RN123_HUMAN E3 ubiquitin-protein ligase RNF123 OS=Homo sapiens OX=9606 GN=RNF123 PE=1 SV=1
12	PDB:3gb8A	0.110	0.117	1.430E-4	958	0.096	0.106	3gb8A.pdb.gz
13	PDB:3gjxA	0.126	0.127	1.482E-4	1041	0.119	0.122	3gjxA.pdb.gz	Crystal Structure of the Nuclear Export Receptor CRM1 in Complex with Snurportin1 and RanGTP.
14	PDB:6xu2A	0.163	0.159	1.591E-4	1091	0.110	0.107	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
15	PDB:3nd2A	0.125	0.144	1.771E-4	861	0.098	0.122	3nd2A.pdb.gz
16	PDB:4bsmA	0.123	0.140	1.835E-4	896	0.102	0.122	4bsmA.pdb.gz
17	PDB:3wyfC	0.127	0.129	2.530E-4	1040	0.102	0.105	3wyfC.pdb.gz	Structural insights into how yrb2p accelerates the assembly of the xpo1p nuclear export complex
18	PDB:3w3uA	0.106	0.108	3.487E-4	1030	0.109	0.113	3w3uA.pdb.gz
19	PDB:2xwuB	0.125	0.139	3.745E-4	910	0.112	0.131	2xwuB.pdb.gz
20	PDB:6vaeA	0.139	0.127	4.021E-4	1198	0.103	0.092	6vaeA.pdb.gz	DNA clamp function of the monoubiquitinated Fanconi anaemia ID complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9Q735	0.0	2066	1028	0.938	0.973	UBE4A_MOUSE Ubiquitin conjugation factor E4 A OS=Mus musculus OX=10090 GN=Ube4a PE=1 SV=1
2	Q14139	0.0	2210	1066	1.000	1.000	UBE4A_HUMAN Ubiquitin conjugation factor E4 A OS=Homo sapiens OX=9606 GN=UBE4A PE=1 SV=2
3	O44007	3.39e-101	345	1089	0.267	0.262	O44007_DICDI NOSA OS=Dictyostelium discoideum OX=44689 GN=nosA PE=2 SV=1
4	Q9LF41	5.17e-95	327	1038	0.291	0.299	UBE4_ARATH Probable ubiquitin conjugation factor E4 OS=Arabidopsis thaliana OX=3702 GN=PUB1 PE=2 SV=1
5	Q9HE05	8.56e-82	290	1010	0.236	0.250	UFD2_SCHPO Ubiquitin conjugation factor E4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ufd2 PE=2 SV=1
6	Q9ES00	9.64e-78	280	1173	0.239	0.217	UBE4B_MOUSE Ubiquitin conjugation factor E4 B OS=Mus musculus OX=10090 GN=Ube4b PE=1 SV=3
7	F1M8V2	2.48e-77	279	1173	0.238	0.217	F1M8V2_RAT Ubiquitin conjugation factor E4 OS=Rattus norvegicus OX=10116 GN=Ube4b PE=1 SV=3
8	O95155	4.26e-73	267	1302	0.235	0.192	UBE4B_HUMAN Ubiquitin conjugation factor E4 B OS=Homo sapiens OX=9606 GN=UBE4B PE=1 SV=1
9	P54860	3.22e-63	234	961	0.151	0.168	UFD2_YEAST E4 ubiquitin-protein ligase UFD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UFD2 PE=1 SV=3
10	Q09349	8.56e-52	200	984	0.132	0.143	UBE4_CAEEL Ubiquitin conjugation factor E4 ufd-2 OS=Caenorhabditis elegans OX=6239 GN=ufd-2 PE=1 SV=2
11	G5ECY6	5.04e-05	48.5	266	0.029	0.117	G5ECY6_CAEEL Hsp70-interacting protein OS=Caenorhabditis elegans OX=6239 GN=chn-1 PE=1 SV=1
12	Q9WUD1	1.79e-04	47.4	304	0.032	0.112	CHIP_MOUSE E3 ubiquitin-protein ligase CHIP OS=Mus musculus OX=10090 GN=Stub1 PE=1 SV=1
13	A0A8I5ZPA4	1.80e-04	47.0	267	0.032	0.127	A0A8I5ZPA4_RAT STIP1 homology and U-box containing protein 1 OS=Rattus norvegicus OX=10116 GN=Stub1 PE=1 SV=1
14	D4A4T0	1.84e-04	47.0	304	0.032	0.112	D4A4T0_RAT STIP1 homology and U-box containing protein 1 OS=Rattus norvegicus OX=10116 GN=Stub1 PE=1 SV=1
15	Q9UNE7	2.08e-04	47.0	303	0.032	0.112	CHIP_HUMAN E3 ubiquitin-protein ligase CHIP OS=Homo sapiens OX=9606 GN=STUB1 PE=1 SV=2
16	Q86DT6	0.005	42.0	221	0.021	0.100	Q86DT6_DROME Hsp70-interacting protein (Fragment) OS=Drosophila melanogaster OX=7227 GN=STUB1 PE=4 SV=1
17	Q9XYW6	0.005	42.4	289	0.022	0.080	Q9XYW6_DROME Carboxy terminus of Hsp70-interacting protein OS=Drosophila melanogaster OX=7227 GN=STUB1 PE=2 SV=1
18	Q925F4	0.006	43.1	539	0.029	0.058	RNF37_MOUSE RING finger protein 37 OS=Mus musculus OX=10090 GN=Ubox5 PE=1 SV=2
19	Q86DT5	0.013	40.8	221	0.021	0.100	Q86DT5_DROME Hsp70-interacting protein (Fragment) OS=Drosophila melanogaster OX=7227 GN=STUB1 PE=4 SV=1
20	Q86DT7	0.013	40.8	221	0.021	0.100	Q86DT7_DROME Hsp70-interacting protein (Fragment) OS=Drosophila melanogaster OX=7227 GN=STUB1 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19191 HEF_HK	4.6e+02	12.7	HEF_HK domain
2	PF04564 U-box	6.1e-29	111.3	U-box domain
3	PF10408 Ufd2P_core	6.9e-150	512.3	Ubiquitin elongating factor core

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9555.ENSPANP00000008632

Rank	PPI partner	STRING score	Description
1	9555.ENSPANP00000019119	0.944	Valosin containing protein
2	9555.ENSPANP00000010904	0.884	Thyroid hormone receptor interactor 12
3	9555.ENSPANP00000009372	0.828	RAD23 homolog A, nucleotide excision repair protein
4	9555.ENSPANP00000019009	0.828	RAD23 homolog B, nucleotide excision repair protein
5	9555.ENSPANP00000012303	0.818	UBX domain protein 4
6	9555.ENSPANP00000020038	0.812	Unc-45 homolog B (C. elegans)
7	9555.ENSPANP00000019332	0.807	Ubiquilin 1
8	9555.ENSPANP00000017900	0.806	Ubiquilin 4
9	9555.ENSPANP00000009449	0.783	Ubiquilin 2
10	9555.ENSPANP00000013375	0.745	Unc-45 homolog A (C. elegans)
11	9555.ENSPANP00000002052	0.743	UBX domain protein 7
12	9555.ENSPANP00000019174	0.740	Phospholipase A2-activating protein
13	9555.ENSPANP00000016339	0.737	NPL4 homolog, ubiquitin recognition factor
14	9555.ENSPANP00000013486	0.733	STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase
15	9555.ENSPANP00000002667	0.729	Ubiquitin protein ligase E3C
16	9555.ENSPANP00000014006	0.720	Uncharacterized protein
17	9555.ENSPANP00000018141	0.720	Spermatogenesis associated 5
18	9555.ENSPANP00000011987	0.714	Ubiquitin specific peptidase 40
19	9555.ENSPANP00000013878	0.701	Ubiquitin specific peptidase 7 (herpes virus-associated)
20	9555.ENSPANP00000017332	0.695	YOD1 deubiquitinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004842	0.991	ubiquitin-protein transferase activity
GO:0061630	0.976	ubiquitin protein ligase activity
GO:0034450	0.806	ubiquitin-ubiquitin ligase activity
GO:0019899	0.381	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0019941	0.985	modification-dependent protein catabolic process
GO:0006511	0.983	ubiquitin-dependent protein catabolic process
GO:0070647	0.691	protein modification by small protein conjugation or removal
GO:0032446	0.542	protein modification by small protein conjugation
GO:0016567	0.448	protein ubiquitination

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1902494	0.996	catalytic complex
GO:0140535	0.995	intracellular protein-containing complex
GO:0110165	0.975	cellular anatomical entity
GO:1990234	0.975	transferase complex
GO:0000151	0.973	ubiquitin ligase complex
GO:0005737	0.970	cytoplasm
GO:0005634	0.967	nucleus
GO:0070013	0.965	intracellular organelle lumen
GO:0005654	0.963	nucleoplasm
GO:0005829	0.600	cytosol
GO:0012505	0.402	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.993	Transferases.

[back to server]