StarFunc result for job id Q14140

User Input

>input (314 residues)
MLGKGGKRKFDEHEDGLEGKIVSPCDGPSKVSYTLQRQTIFNISLMKLYNHRPLTEPSLQ
KTVLINNMLRRIQEELKQEGSLRPMFTPSSQPTTEPSDSYREAPPAFSHLASPSSHPCDL
GSTTPLEACLTPASLLEDDDDTFCTSQAMQPTAPTKLSPPALLPEKDSFSSALDEIEELC
PTSTSTEAATAATDSVKGTSSEAGTQKLDGPQESRADDSKLMDSLPGNFEITTSTGFLTD
LTLDDILFADIDTSMYDFDPCTSSSGTASKMAPVSADDLLKTLAPYSSQPVTPSQPFKMD
LTELDHIMEVLVGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14140	0.999	0.999	1.028E-47	314	1.000	1.000	Q14140.pdb.gz	SRTD2_HUMAN SERTA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SERTAD2 PE=1 SV=1
2	AFDB:Q9JJG5	0.315	0.319	1.469E-37	309	0.863	0.877	Q9JJG5.pdb.gz	SRTD2_MOUSE SERTA domain-containing protein 2 OS=Mus musculus OX=10090 GN=Sertad2 PE=1 SV=2
3	AFDB:Q9NUC0	0.152	0.138	1.467E-2	356	0.169	0.149	Q9NUC0.pdb.gz	SRTD4_HUMAN SERTA domain-containing protein 4 OS=Homo sapiens OX=9606 GN=SERTAD4 PE=1 SV=1
4	AFDB:G5E972	0.104	0.082	5.284E-2	414	0.166	0.126	G5E972.pdb.gz	G5E972_HUMAN Thymopoietin OS=Homo sapiens OX=9606 GN=TMPO PE=1 SV=1
5	AFDB:Q5A5R4	0.169	0.060	7.760E-2	1189	0.137	0.036	Q5A5R4.pdb.gz	Q5A5R4_CANAL DNA helicase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SGS1 PE=3 SV=1
6	AFDB:Q10F03	0.114	0.074	1.215E-1	529	0.124	0.074	Q10F03.pdb.gz	FLO6_ORYSJ Protein FLOURY ENDOSPERM 6, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=FLO6 PE=1 SV=1
7	AFDB:A0JPE5	0.099	0.100	1.295E-1	309	0.182	0.184	A0JPE5.pdb.gz	A0JPE5_DANRE Mix-type homeobox gene 1 OS=Danio rerio OX=7955 GN=mtx1 PE=2 SV=1
8	AFDB:Q62865	0.139	0.047	1.570E-1	1141	0.159	0.044	Q62865.pdb.gz	PDE3A_RAT cGMP-inhibited 3',5'-cyclic phosphodiesterase 3A OS=Rattus norvegicus OX=10116 GN=Pde3a PE=1 SV=1
9	AFDB:Q5VY09	0.137	0.132	1.785E-1	327	0.162	0.156	Q5VY09.pdb.gz	IER5_HUMAN Immediate early response gene 5 protein OS=Homo sapiens OX=9606 GN=IER5 PE=1 SV=3
10	AFDB:O95208	0.078	0.045	1.903E-1	641	0.210	0.103	O95208.pdb.gz	EPN2_HUMAN Epsin-2 OS=Homo sapiens OX=9606 GN=EPN2 PE=1 SV=3
11	PDB:6ta5D	0.154	0.142	1.277	345	0.048	0.043	6ta5D.pdb.gz
12	PDB:7pp4f	0.138	0.260	1.547	142	0.038	0.085	7pp4f.pdb.gz	Mycobacterium RbpA cooperates with the stress-response sigma-B subunit of RNA polymerase in promoter DNA unwinding.
13	PDB:8ap7O	0.138	0.343	1.999	96	0.045	0.146	8ap7O.pdb.gz	An ancestral interaction module promotes oligomerization in divergent mitochondrial ATP synthases.
14	PDB:7v53A	0.091	0.033	2.754	930	0.048	0.016	7v53A.pdb.gz
15	PDB:6s1mA	0.139	0.052	2.936	1010	0.041	0.013	6s1mA.pdb.gz	Structure of the processive human Pol delta holoenzyme.
16	PDB:6jpfA	0.110	0.063	3.337	610	0.025	0.013	6jpfA.pdb.gz
17	PDB:5svaT	0.138	0.420	3.558	91	0.045	0.154	5svaT.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
18	PDB:3piwA	0.157	0.284	3.794	154	0.032	0.065	3piwA.pdb.gz
19	PDB:6agbK	0.143	0.304	3.794	128	0.022	0.055	6agbK.pdb.gz	Structural insight into precursor tRNA processing by yeast ribonuclease P.
20	PDB:3lssA	0.114	0.088	4.044	438	0.022	0.016	3lssA.pdb.gz	X-ray crystal structure of Seryl-tRNA synthetase from the eukaryotic parasite Trypanosoma brucei.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14140	0.0	631	314	1.000	1.000	SRTD2_HUMAN SERTA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SERTAD2 PE=1 SV=1
2	Q9JJG5	0.0	530	309	0.863	0.877	SRTD2_MOUSE SERTA domain-containing protein 2 OS=Mus musculus OX=10090 GN=Sertad2 PE=1 SV=2
3	Q9BXL8	4.71e-18	84.0	241	0.274	0.357	CDCA4_HUMAN Cell division cycle-associated protein 4 OS=Homo sapiens OX=9606 GN=CDCA4 PE=1 SV=1
4	Q9CWM2	1.97e-13	70.9	237	0.115	0.152	CDCA4_MOUSE Cell division cycle-associated protein 4 OS=Mus musculus OX=10090 GN=Cdca4 PE=2 SV=2
5	Q9JL10	5.35e-07	52.0	236	0.283	0.377	SRTD1_MOUSE SERTA domain-containing protein 1 OS=Mus musculus OX=10090 GN=Sertad1 PE=1 SV=1
6	Q9NHB9	0.001	42.7	912	0.073	0.025	Q9NHB9_DROME RE26467p OS=Drosophila melanogaster OX=7227 GN=tara PE=2 SV=1
7	Q9VEX7	0.001	42.7	916	0.073	0.025	Q9VEX7_DROME RE12330p OS=Drosophila melanogaster OX=7227 GN=tara PE=2 SV=2
8	Q9NHC1	0.002	42.4	912	0.073	0.025	Q9NHC1_DROME Tara 1B isoform OS=Drosophila melanogaster OX=7227 GN=tara PE=2 SV=1
9	Q9NHC2	0.002	42.4	916	0.073	0.025	Q9NHC2_DROME Tara 1A isoform OS=Drosophila melanogaster OX=7227 GN=tara PE=2 SV=1
10	Q53GC0	0.026	38.1	236	0.048	0.064	Q53GC0_HUMAN SERTA domain containing 1 variant (Fragment) OS=Homo sapiens OX=9606 GN=SERTAD1 PE=1 SV=1
11	Q9UHV2	0.026	38.1	236	0.048	0.064	SRTD1_HUMAN SERTA domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SERTAD1 PE=1 SV=2
12	Q9Y128	1.7	32.7	601	0.067	0.035	Q9Y128_DROME Ceramide transfer protein OS=Drosophila melanogaster OX=7227 GN=cert PE=1 SV=1
13	Q9VS89	2.1	32.7	1618	0.064	0.012	Q9VS89_DROME FI18763p1 OS=Drosophila melanogaster OX=7227 GN=frac PE=2 SV=4
14	Q9NUC0	3.7	31.6	356	0.080	0.070	SRTD4_HUMAN SERTA domain-containing protein 4 OS=Homo sapiens OX=9606 GN=SERTAD4 PE=1 SV=1
15	P0DP43	4.4	31.6	985	0.061	0.019	CTSRE_MOUSE Cation channel sperm-associated auxiliary subunit epsilon OS=Mus musculus OX=10090 GN=Catspere PE=1 SV=1
16	F1NBT0	6.8	31.2	969	0.054	0.018	STK10_CHICK Serine/threonine-protein kinase 10 OS=Gallus gallus OX=9031 GN=STK10 PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10937 S36_mt	4.5e+02	13.9	Ribosomal protein S36, mitochondrial
2	PF06031 SERTA	4.2e-14	63.2	SERTA motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000326933

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000332148	0.705	Zinc finger protein DZIP1L
2	9606.ENSP00000325414	0.670	SERTA domain-containing protein 3
3	9606.ENSP00000384863	0.594	Exportin-1
4	9606.ENSP00000336750	0.579	SPT7 like, STAGA complex gamma subunit
5	9606.ENSP00000393183	0.575	DDB1- and CUL4-associated factor 1
6	9606.ENSP00000340330	0.571	Histone acetyltransferase KAT5
7	9606.ENSP00000355979	0.558	SERTA domain containing 4
8	9606.ENSP00000360138	0.556	Ligand-dependent corepressor
9	9606.ENSP00000359483	0.554	Volume-regulated anion channel subunit LRRC8C
10	9606.ENSP00000332674	0.552	Volume-regulated anion channel subunit LRRC8B
11	9606.ENSP00000346283	0.507	Histidine rich carboxyl terminus 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140110	0.305	transcription regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0048519	0.957	negative regulation of biological process
GO:0019222	0.923	regulation of metabolic process
GO:0048523	0.897	negative regulation of cellular process
GO:0040008	0.875	regulation of growth
GO:0060255	0.751	regulation of macromolecule metabolic process
GO:0080090	0.746	regulation of primary metabolic process
GO:0051171	0.683	regulation of nitrogen compound metabolic process
GO:0051128	0.679	regulation of cellular component organization
GO:0031323	0.671	regulation of cellular metabolic process
GO:0010468	0.655	regulation of gene expression
GO:0006355	0.650	regulation of DNA-templated transcription
GO:0001558	0.556	regulation of cell growth
GO:0045926	0.513	negative regulation of growth
GO:0048518	0.493	positive regulation of biological process
GO:0048522	0.475	positive regulation of cellular process
GO:0009987	0.442	cellular process
GO:0051173	0.424	positive regulation of nitrogen compound metabolic process
GO:0010604	0.424	positive regulation of macromolecule metabolic process
GO:0031325	0.424	positive regulation of cellular metabolic process
GO:0045893	0.348	positive regulation of DNA-templated transcription
GO:0030308	0.308	negative regulation of cell growth

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.999	cytosol
GO:0016020	0.678	membrane
GO:0071944	0.441	cell periphery
GO:0005886	0.434	plasma membrane
GO:0032991	0.416	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]