StarFunc result for job id Q14142

User Input

>input (442 residues)
MAGAATGSRTPGRSELVEGCGWRCPEHGDRVAELFCRRCRRCVCALCPVLGAHRGHPVGL
ALEAAVHVQKLSQECLKQLAIKKQQHIDNITQIEDATEKLKANAESSKTWLKGKFTELRL
LLDEEEALAKKFIDKNTQLTLQVYREQADSCREQLDIMNDLSNRVWSISQEPDPVQRLQA
YTATEQEMQQQMSLGELCHPVPLSFEPVKSFFKGLVEAVESTLQTPLDIRLKESINCQLS
DPSSTKPGTLLKTSPSPERSLLLKYARTPTLDPDTMHARLRLSADRLTVRCGLLGSLGPV
PVLRFDALWQVLARDCFATGRHYWEVDVQEAGAGWWVGAAYASLRRRGASAAARLGCNRQ
SWCLKRYDLEYWAFHDGQRSRLRPRDDLDRLGVFLDYEAGVLAFYDVTGGMSHLHTFRAT
FQEPLYPALRLWEGAISIPRLP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14142	1.000	1.000	4.146E-82	442	1.000	1.000	Q14142.pdb.gz	TRI14_HUMAN Tripartite motif-containing protein 14 OS=Homo sapiens OX=9606 GN=TRIM14 PE=1 SV=2
2	AFDB:Q6PJ69	0.409	0.352	1.749E-30	517	0.251	0.215	Q6PJ69.pdb.gz	TRI65_HUMAN E3 ubiquitin-protein ligase TRIM65 OS=Homo sapiens OX=9606 GN=TRIM65 PE=1 SV=3
3	AFDB:A2BFT4	0.400	0.311	5.457E-30	573	0.251	0.194	A2BFT4.pdb.gz
4	AFDB:Q923T7	0.393	0.347	4.228E-29	510	0.253	0.220	Q923T7.pdb.gz	TRIM7_MOUSE E3 ubiquitin-protein ligase TRIM7 OS=Mus musculus OX=10090 GN=Trim7 PE=2 SV=2
5	AFDB:Q6P6S3	0.383	0.378	5.015E-29	448	0.242	0.239	Q6P6S3.pdb.gz	BSPRY_RAT B box and SPRY domain-containing protein OS=Rattus norvegicus OX=10116 GN=Bspry PE=1 SV=2
6	AFDB:F1QZK7	0.422	0.287	5.619E-29	664	0.226	0.151	F1QZK7.pdb.gz
7	AFDB:Q14258	0.394	0.278	1.050E-28	630	0.217	0.152	Q14258.pdb.gz	TRI25_HUMAN E3 ubiquitin/ISG15 ligase TRIM25 OS=Homo sapiens OX=9606 GN=TRIM25 PE=1 SV=2
8	AFDB:Q9C029	0.384	0.339	1.112E-28	511	0.253	0.219	Q9C029.pdb.gz	TRIM7_HUMAN E3 ubiquitin-protein ligase TRIM7 OS=Homo sapiens OX=9606 GN=TRIM7 PE=1 SV=2
9	AFDB:Q5NCC9	0.392	0.358	4.879E-28	485	0.219	0.200	Q5NCC9.pdb.gz	TRI58_MOUSE E3 ubiquitin-protein ligase TRIM58 OS=Mus musculus OX=10090 GN=Trim58 PE=2 SV=1
10	AFDB:Q61510	0.394	0.276	4.879E-28	634	0.215	0.150	Q61510.pdb.gz	TRI25_MOUSE E3 ubiquitin/ISG15 ligase TRIM25 OS=Mus musculus OX=10090 GN=Trim25 PE=1 SV=2
11	PDB:7y4sA	0.366	0.468	9.356E-18	343	0.158	0.204	7y4sA.pdb.gz
12	PDB:4b3nA	0.330	0.265	5.475E-13	557	0.102	0.081	4b3nA.pdb.gz	Structural Insight Into HIV-1 Capsid Recognition by Rhesus Trim5Alpha
13	PDB:7ccbA	0.293	0.740	1.365E-8	164	0.068	0.183	7ccbA.pdb.gz
14	PDB:7nscA	0.314	0.486	2.156E-6	276	0.070	0.112	7nscA.pdb.gz
15	PDB:7nsba	0.248	0.198	4.150E-5	568	0.068	0.053	7nsba.pdb.gz
16	PDB:6swy1	0.231	0.191	8.212E-5	542	0.100	0.081	6swy1.pdb.gz
17	PDB:7m6aA	0.228	0.025	1.223E-4	4306	0.057	0.006	7m6aA.pdb.gz	High-resolution structure of the membrane-embedded skeletal muscle ryanodine receptor.
18	PDB:6venO	0.275	0.377	1.535E-4	315	0.063	0.089	6venO.pdb.gz	Structural basis for COMPASS recognition of an H2B-ubiquitinated nucleosome.
19	PDB:7u9tA	0.233	0.028	1.535E-4	4229	0.043	0.004	7u9tA.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.
20	PDB:7tzcA	0.228	0.025	1.625E-4	4404	0.052	0.005	7tzcA.pdb.gz	A drug and ATP binding site in type 1 ryanodine receptor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14142	0.0	910	442	1.000	1.000	TRI14_HUMAN Tripartite motif-containing protein 14 OS=Homo sapiens OX=9606 GN=TRIM14 PE=1 SV=2
2	Q08CC1	3.35e-34	136	573	0.285	0.220	Q08CC1_DANRE FinTRIM family, member 82 OS=Danio rerio OX=7955 GN=si:dkey-252h13.6 PE=1 SV=1
3	Q923T7	2.94e-29	121	510	0.267	0.231	TRIM7_MOUSE E3 ubiquitin-protein ligase TRIM7 OS=Mus musculus OX=10090 GN=Trim7 PE=2 SV=2
4	A0A024RCP5	3.92e-29	121	518	0.267	0.228	A0A024RCP5_HUMAN TRIM39 OS=Homo sapiens OX=9606 PE=4 SV=1
5	Q9HCM9	3.92e-29	121	518	0.267	0.228	TRI39_HUMAN E3 ubiquitin-protein ligase TRIM39 OS=Homo sapiens OX=9606 GN=TRIM39 PE=1 SV=2
6	Q9C029	2.46e-26	113	511	0.269	0.233	TRIM7_HUMAN E3 ubiquitin-protein ligase TRIM7 OS=Homo sapiens OX=9606 GN=TRIM7 PE=1 SV=2
7	Q80V85	9.46e-25	108	475	0.253	0.236	TRI62_MOUSE E3 ubiquitin-protein ligase TRIM62 OS=Mus musculus OX=10090 GN=Trim62 PE=2 SV=1
8	P19474	1.12e-24	108	475	0.253	0.236	RO52_HUMAN E3 ubiquitin-protein ligase TRIM21 OS=Homo sapiens OX=9606 GN=TRIM21 PE=1 SV=1
9	Q9BVG3	2.53e-24	107	475	0.253	0.236	TRI62_HUMAN E3 ubiquitin-protein ligase TRIM62 OS=Homo sapiens OX=9606 GN=TRIM62 PE=1 SV=1
10	Q5NCC3	5.44e-24	107	630	0.292	0.205	TRI41_MOUSE E3 ubiquitin-protein ligase TRIM41 OS=Mus musculus OX=10090 GN=Trim41 PE=1 SV=1
11	A0A1U9X8R9	1.14e-23	105	513	0.278	0.240	A0A1U9X8R9_HUMAN RING-type E3 ubiquitin transferase OS=Homo sapiens OX=9606 PE=4 SV=2
12	P14373	1.14e-23	105	513	0.278	0.240	TRI27_HUMAN Zinc finger protein RFP OS=Homo sapiens OX=9606 GN=TRIM27 PE=1 SV=1
13	Q62158	1.57e-23	105	513	0.278	0.240	TRI27_MOUSE Zinc finger protein RFP OS=Mus musculus OX=10090 GN=Trim27 PE=1 SV=2
14	Q99PP9	2.12e-23	105	556	0.271	0.216	TRI16_MOUSE Tripartite motif-containing protein 16 OS=Mus musculus OX=10090 GN=Trim16 PE=1 SV=2
15	Q8WV44	1.28e-22	102	630	0.290	0.203	TRI41_HUMAN E3 ubiquitin-protein ligase TRIM41 OS=Homo sapiens OX=9606 GN=TRIM41 PE=1 SV=3
16	Q14258	2.32e-22	102	630	0.267	0.187	TRI25_HUMAN E3 ubiquitin/ISG15 ligase TRIM25 OS=Homo sapiens OX=9606 GN=TRIM25 PE=1 SV=2
17	Q86XT4	3.59e-22	100	487	0.269	0.244	TRI50_HUMAN E3 ubiquitin-protein ligase TRIM50 OS=Homo sapiens OX=9606 GN=TRIM50 PE=1 SV=2
18	O70583	6.32e-22	100	680	0.154	0.100	TRI18_MOUSE E3 ubiquitin-protein ligase Midline-1 OS=Mus musculus OX=10090 GN=Mid1 PE=1 SV=2
19	Q9C030	1.16e-21	99.4	488	0.244	0.221	TRIM6_HUMAN Tripartite motif-containing protein 6 OS=Homo sapiens OX=9606 GN=TRIM6 PE=1 SV=1
20	Q5NCC9	5.47e-21	97.4	485	0.242	0.221	TRI58_MOUSE E3 ubiquitin-protein ligase TRIM58 OS=Mus musculus OX=10090 GN=Trim58 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13057 DUF3919	1.7e+02	13.3	Protein of unknown function (DUF3919)
2	PF13765 PRY	1.1e-05	36.2	SPRY-associated domain
3	PF00622 SPRY	2.3e-11	55.2	SPRY domain
4	PF00643 zf-B_box	3.6e-07	41.5	B-box zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000344208

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000483825	0.979	NF-kappa-B essential modulator
2	9606.ENSP00000261601	0.960	Ubiquitin carboxyl-terminal hydrolase 14
3	9606.ENSP00000401980	0.959	Mitochondrial antiviral-signaling protein
4	9606.ENSP00000392147	0.926	Protein phosphatase 6 catalytic subunit
5	9606.ENSP00000295756	0.738	T-cell receptor-associated transmembrane adapter 1
6	9606.ENSP00000359339	0.729	Cyclic GMP-AMP synthase
7	9606.ENSP00000263182	0.657	Gamma-butyrobetaine dioxygenase
8	9606.ENSP00000369213	0.656	Probable ATP-dependent RNA helicase DDX58
9	9606.ENSP00000284274	0.642	Ubiquitin thioesterase otulin
10	9606.ENSP00000315112	0.642	E3 ubiquitin-protein ligase RNF31
11	9606.ENSP00000329967	0.602	Serine/threonine-protein kinase TBK1
12	9606.ENSP00000307954	0.588	Membrane protein FAM174A
13	9606.ENSP00000299413	0.577	Tripartite motif-containing protein 44
14	9606.ENSP00000356426	0.568	TGF-beta-activated kinase 1 and MAP3K7-binding protein 2
15	9606.ENSP00000365924	0.558	E3 ubiquitin-protein ligase TRIM31
16	9606.ENSP00000351777	0.548	Transitional endoplasmic reticulum ATPase
17	9606.ENSP00000305161	0.531	E3 ubiquitin-protein ligase TRIM56
18	9606.ENSP00000302120	0.506	Probable E3 ubiquitin-protein ligase TRIM8
19	9606.ENSP00000311219	0.505	Tripartite motif-containing protein 59
20	9606.ENSP00000410446	0.503	Tripartite motif-containing protein 26

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003713	1.000	transcription coactivator activity
GO:0003824	0.458	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006950	0.990	response to stress
GO:0050794	0.987	regulation of cellular process
GO:0051707	0.980	response to other organism
GO:0006952	0.975	defense response
GO:0060255	0.975	regulation of macromolecule metabolic process
GO:0098542	0.963	defense response to other organism
GO:0002376	0.949	immune system process
GO:0031323	0.946	regulation of cellular metabolic process
GO:0080090	0.942	regulation of primary metabolic process
GO:0051171	0.942	regulation of nitrogen compound metabolic process
GO:0048519	0.938	negative regulation of biological process
GO:0010468	0.937	regulation of gene expression
GO:0051091	0.932	positive regulation of DNA-binding transcription factor activity
GO:0006955	0.925	immune response
GO:0045087	0.922	innate immune response
GO:0009987	0.673	cellular process
GO:0048518	0.607	positive regulation of biological process
GO:0051092	0.525	positive regulation of NF-kappaB transcription factor activity
GO:0008152	0.498	metabolic process
GO:0071704	0.490	organic substance metabolic process
GO:0048525	0.469	negative regulation of viral process
GO:0048583	0.438	regulation of response to stimulus
GO:0044238	0.419	primary metabolic process
GO:0048522	0.370	positive regulation of cellular process
GO:0009615	0.365	response to virus
GO:0006807	0.329	nitrogen compound metabolic process
GO:0043170	0.328	macromolecule metabolic process
GO:0009966	0.326	regulation of signal transduction
GO:0019538	0.305	protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043229	0.873	intracellular organelle
GO:0043231	0.850	intracellular membrane-bounded organelle
GO:0005829	0.820	cytosol
GO:0016020	0.407	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]