StarFunc result for job id Q14145

User Input

>input (624 residues)
MQPDPRPSGAGACCRFLPLQSQCPEGAGDAVMYASTECKAEVTPSQHGNRTFSYTLEDHT
KQAFGIMNELRLSQQLCDVTLQVKYQDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGM
EVVSIEGIHPKVMERLIEFAYTASISMGEKCVLHVMNGAVMYQIDSVVRACSDFLVQQLD
PSNAIGIANFAEQIGCVELHQRAREYIYMHFGEVAKQEEFFNLSHCQLVTLISRDDLNVR
CESEVFHACINWVKYDCEQRRFYVQALLRAVRCHSLTPNFLQMQLQKCEILQSDSRCKDY
LVKIFEELTLHKPTQVMPCRAPKVGRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADLQV
PRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGV
IDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDG
TNRLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVE
TETWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSG
RSGVGVAVTMEPCRKQIDQQNCTC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R7C0	0.910	0.910	0.000	624	1.000	1.000	A0A024R7C0.pdb.gz
2	AFDB:A0A2R8Q1W5	0.908	0.965	1.079E-98	587	0.726	0.772	A0A2R8Q1W5.pdb.gz	KEP1B_DANRE Kelch-like ECH-associated protein 1B OS=Danio rerio OX=7955 GN=keap1b PE=1 SV=1
3	AFDB:Q1ECZ2	0.829	0.858	1.414E-80	601	0.500	0.519	Q1ECZ2.pdb.gz	KEP1A_DANRE Kelch-like ECH-associated protein 1A OS=Danio rerio OX=7955 GN=keap1a PE=1 SV=1
4	AFDB:Q7KSF5	0.877	0.709	2.362E-76	776	0.460	0.370	Q7KSF5.pdb.gz	Q7KSF5_DROME FI11917p OS=Drosophila melanogaster OX=7227 GN=Keap1 PE=2 SV=1
5	AFDB:Q9VUU5	0.776	0.778	1.434E-64	623	0.364	0.364	Q9VUU5.pdb.gz	KLHDB_DROME Kelch-like protein diablo OS=Drosophila melanogaster OX=7227 GN=dbo PE=1 SV=1
6	AFDB:Q9Y2M5	0.510	0.521	4.298E-64	609	0.364	0.373	Q9Y2M5.pdb.gz	KLH20_HUMAN Kelch-like protein 20 OS=Homo sapiens OX=9606 GN=KLHL20 PE=1 SV=4
7	AFDB:Q6TDP4	0.663	0.648	1.223E-63	642	0.365	0.355	Q6TDP4.pdb.gz	KLH17_HUMAN Kelch-like protein 17 OS=Homo sapiens OX=9606 GN=KLHL17 PE=1 SV=1
8	AFDB:O95198	0.486	0.511	4.277E-62	593	0.353	0.371	O95198.pdb.gz	KLHL2_HUMAN Kelch-like protein 2 OS=Homo sapiens OX=9606 GN=KLHL2 PE=1 SV=2
9	AFDB:E0CZ16	0.649	0.682	6.167E-62	587	0.348	0.370	E0CZ16.pdb.gz	KLHL3_MOUSE Kelch-like protein 3 OS=Mus musculus OX=10090 GN=Klhl3 PE=1 SV=2
10	AFDB:Q53G59	0.546	0.595	8.871E-61	568	0.330	0.363	Q53G59.pdb.gz	KLH12_HUMAN Kelch-like protein 12 OS=Homo sapiens OX=9606 GN=KLHL12 PE=1 SV=2
11	PDB:6wcqC	0.189	0.865	1.224E-16	130	0.207	0.992	6wcqC.pdb.gz
12	PDB:5gqtA	0.352	0.462	2.064E-16	470	0.103	0.136	5gqtA.pdb.gz
13	PDB:2uvkB	0.368	0.639	3.659E-15	349	0.074	0.132	2uvkB.pdb.gz
14	PDB:5gq0A	0.347	0.622	8.016E-15	338	0.093	0.172	5gq0A.pdb.gz
15	PDB:2zwaB	0.335	0.308	8.857E-13	683	0.131	0.120	2zwaB.pdb.gz	Structural basis of tRNA modification with CO2 fixation and methylation by wybutosine synthesizing enzyme TYW4.
16	PDB:1n6dA	0.300	0.192	3.076E-8	1023	0.056	0.034	1n6dA.pdb.gz	Navigation Inside a Protease: Substrate Selection and Product Exit in the Tricorn Protease from Thermoplasma acidophilum
17	PDB:5o9zL	0.310	0.400	3.598E-8	459	0.062	0.085	5o9zL.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
18	PDB:2hqsA	0.337	0.484	4.209E-8	412	0.054	0.083	2hqsA.pdb.gz
19	PDB:1ri6A	0.310	0.517	9.716E-8	333	0.066	0.123	1ri6A.pdb.gz
20	PDB:7mq8SG	0.294	0.431	9.716E-8	389	0.074	0.118	7mq8SG.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8Q1W5	0.0	947	587	0.729	0.775	KEP1B_DANRE Kelch-like ECH-associated protein 1B OS=Danio rerio OX=7955 GN=keap1b PE=1 SV=1
2	K7ESE0	0.0	584	279	0.447	1.000	K7ESE0_HUMAN Kelch-like ECH-associated protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=KEAP1 PE=1 SV=1
3	P57790	0.0	1234	624	0.938	0.938	KEAP1_RAT Kelch-like ECH-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Keap1 PE=2 SV=1
4	Q14145	0.0	1310	624	1.000	1.000	KEAP1_HUMAN Kelch-like ECH-associated protein 1 OS=Homo sapiens OX=9606 GN=KEAP1 PE=1 SV=2
5	Q1ECZ2	0.0	645	601	0.498	0.517	KEP1A_DANRE Kelch-like ECH-associated protein 1A OS=Danio rerio OX=7955 GN=keap1a PE=1 SV=1
6	Q7KSF5	0.0	574	776	0.447	0.360	Q7KSF5_DROME FI11917p OS=Drosophila melanogaster OX=7227 GN=Keap1 PE=2 SV=1
7	Q9VEN5	0.0	574	744	0.447	0.375	Q9VEN5_DROME Keap1, isoform A OS=Drosophila melanogaster OX=7227 GN=Keap1 PE=3 SV=1
8	Q9Z2X8	0.0	1239	624	0.941	0.941	KEAP1_MOUSE Kelch-like ECH-associated protein 1 OS=Mus musculus OX=10090 GN=Keap1 PE=1 SV=1
9	Q8IGL4	2.07e-169	498	608	0.381	0.391	Q8IGL4_DROME RE68961p OS=Drosophila melanogaster OX=7227 GN=Keap1 PE=2 SV=1
10	K7EJD8	9.65e-155	445	213	0.341	1.000	K7EJD8_HUMAN Kelch-like ECH-associated protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=KEAP1 PE=1 SV=2
11	K7EJ49	4.82e-154	443	212	0.340	1.000	K7EJ49_HUMAN Kelch-like ECH-associated protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=KEAP1 PE=1 SV=1
12	Q9Y2M5	1.37e-131	401	609	0.364	0.373	KLH20_HUMAN Kelch-like protein 20 OS=Homo sapiens OX=9606 GN=KLHL20 PE=1 SV=4
13	Q9VUU5	5.16e-124	382	623	0.356	0.356	KLHDB_DROME Kelch-like protein diablo OS=Drosophila melanogaster OX=7227 GN=dbo PE=1 SV=1
14	Q8K430	2.51e-123	380	640	0.349	0.341	KLH17_RAT Kelch-like protein 17 OS=Rattus norvegicus OX=10116 GN=Klhl17 PE=1 SV=1
15	Q6TDP4	9.10e-123	379	642	0.351	0.341	KLH17_HUMAN Kelch-like protein 17 OS=Homo sapiens OX=9606 GN=KLHL17 PE=1 SV=1
16	Q5U374	8.02e-121	372	564	0.337	0.372	KLH12_DANRE Kelch-like protein 12 OS=Danio rerio OX=7955 GN=klhl12 PE=2 SV=2
17	Q96PQ7	5.37e-120	375	755	0.332	0.274	KLHL5_HUMAN Kelch-like protein 5 OS=Homo sapiens OX=9606 GN=KLHL5 PE=1 SV=3
18	Q53G59	3.12e-119	367	568	0.337	0.370	KLH12_HUMAN Kelch-like protein 12 OS=Homo sapiens OX=9606 GN=KLHL12 PE=1 SV=2
19	Q9VGE5	6.02e-119	367	575	0.327	0.355	Q9VGE5_DROME Kelch-like protein diablo OS=Drosophila melanogaster OX=7227 GN=KLHL18 PE=2 SV=1
20	Q04652	2.21e-117	383	1477	0.357	0.151	KELC_DROME Ring canal kelch protein OS=Drosophila melanogaster OX=7227 GN=kel PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07707 BACK	7.8e-30	114.3	BTB And C-terminal Kelch
2	PF00651 BTB	9.3e-27	104.8	BTB/POZ domain
3	PF05096 Glu_cyclase_2	4e+02	11.8	Glutamine cyclotransferase
4	PF01344 Kelch_1	7.8e-83	283.2	Kelch motif
5	PF07646 Kelch_2	2.6e-26	101.9	Kelch motif
6	PF13415 Kelch_3	1e-27	107.2	Galactose oxidase, central domain
7	PF13418 Kelch_4	9e-19	78.5	Galactose oxidase, central domain
8	PF13854 Kelch_5	24	16.1	Kelch motif
9	PF13964 Kelch_6	6.5e-48	170.8	Kelch motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000171111

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216225	0.999	E3 ubiquitin-protein ligase RBX1
2	9606.ENSP00000264414	0.999	Cullin-3
3	9606.ENSP00000374455	0.999	Sequestosome-1
4	9606.ENSP00000380252	0.999	Nuclear factor erythroid 2-related factor 2
5	9606.ENSP00000261584	0.998	Partner and localizer of BRCA2
6	9606.ENSP00000430684	0.998	Inhibitor of nuclear factor kappa-B kinase subunit beta
7	9606.ENSP00000438465	0.998	Serine/threonine-protein phosphatase PGAM5, mitochondrial
8	9606.ENSP00000344547	0.997	Prothymosin alpha
9	9606.ENSP00000354855	0.994	Nuclear factor erythroid 2-related factor 1
10	9606.ENSP00000284503	0.992	Endonuclease 8-like 2
11	9606.ENSP00000327048	0.989	Transcription factor Maf
12	9606.ENSP00000353701	0.986	Dipeptidyl peptidase 3
13	9606.ENSP00000451828	0.970	RAC-alpha serine/threonine-protein kinase
14	9606.ENSP00000312397	0.964	Kelch-like protein 3
15	9606.ENSP00000307235	0.958	Eukaryotic translation initiation factor 2-alpha kinase 3
16	9606.ENSP00000253063	0.955	Sestrin-2
17	9606.ENSP00000418770	0.942	Protein/nucleic acid deglycase DJ-1
18	9606.ENSP00000329117	0.930	APC membrane recruitment protein 1
19	9606.ENSP00000479101	0.928	Ectoderm-neural cortex protein 1
20	9606.ENSP00000377001	0.926	Speckle-type POZ protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.780	identical protein binding
GO:0003824	0.337	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.994	organic substance metabolic process
GO:0044238	0.992	primary metabolic process
GO:0044237	0.989	cellular metabolic process
GO:0050896	0.986	response to stimulus
GO:0051716	0.984	cellular response to stimulus
GO:0050794	0.984	regulation of cellular process
GO:0006807	0.982	nitrogen compound metabolic process
GO:0019222	0.980	regulation of metabolic process
GO:0042221	0.958	response to chemical
GO:0043412	0.955	macromolecule modification
GO:0036211	0.946	protein modification process
GO:0009894	0.919	regulation of catabolic process
GO:0080090	0.917	regulation of primary metabolic process
GO:0051171	0.916	regulation of nitrogen compound metabolic process
GO:0070647	0.913	protein modification by small protein conjugation or removal
GO:0016567	0.903	protein ubiquitination
GO:0048518	0.896	positive regulation of biological process
GO:0031323	0.895	regulation of cellular metabolic process
GO:0060255	0.894	regulation of macromolecule metabolic process
GO:0048522	0.790	positive regulation of cellular process
GO:0030163	0.784	protein catabolic process
GO:0006508	0.772	proteolysis
GO:0009893	0.719	positive regulation of metabolic process
GO:0006950	0.682	response to stress
GO:0051603	0.673	proteolysis involved in protein catabolic process
GO:0010468	0.669	regulation of gene expression
GO:0006511	0.662	ubiquitin-dependent protein catabolic process
GO:0009889	0.657	regulation of biosynthetic process
GO:0070887	0.657	cellular response to chemical stimulus
GO:0019219	0.656	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.654	regulation of cellular biosynthetic process
GO:0010556	0.653	regulation of macromolecule biosynthetic process
GO:0051252	0.633	regulation of RNA metabolic process
GO:0051173	0.597	positive regulation of nitrogen compound metabolic process
GO:0010604	0.573	positive regulation of macromolecule metabolic process
GO:0051246	0.567	regulation of protein metabolic process
GO:0031325	0.525	positive regulation of cellular metabolic process
GO:0048519	0.484	negative regulation of biological process
GO:0033554	0.477	cellular response to stress
GO:0065009	0.356	regulation of molecular function
GO:0031329	0.347	regulation of cellular catabolic process
GO:0006979	0.346	response to oxidative stress
GO:0006355	0.341	regulation of DNA-templated transcription
GO:0010033	0.319	response to organic substance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0032991	0.997	protein-containing complex
GO:0005654	0.996	nucleoplasm
GO:0043232	0.992	intracellular non-membrane-bounded organelle
GO:0005829	0.987	cytosol
GO:0005856	0.952	cytoskeleton
GO:1902494	0.899	catalytic complex
GO:1990234	0.871	transferase complex
GO:0140535	0.869	intracellular protein-containing complex
GO:0000151	0.740	ubiquitin ligase complex
GO:0012505	0.701	endomembrane system
GO:0031461	0.683	cullin-RING ubiquitin ligase complex
GO:0031463	0.643	Cul3-RING ubiquitin ligase complex
GO:0015630	0.474	microtubule cytoskeleton
GO:0005813	0.399	centrosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]