StarFunc result for job id Q14146

User Input

>input (1524 residues)
MAAVYSGISLKLKSKTTSWEDKLKLAHFAWISHQCFLPNKEQVLLDWARQSLVAFYKKKL
ELKEDIVERLWIYIDNILHSRKLQNLLKNGKTINLQISLVKIINERVAEFSLSGSQRNIC
AVLRCCQGILSTPALAVIYTAKQELMVALLSQLCWSACRQPEGAVVAQLFEVIHLALGHY
LLILQQQVNPRRAFGDVTAHLLQPCLVLRHLLSGGTWTQAGQGQLRQVLSRDIRSQIEAM
FRGGIFQPELLSSYKEGLLDQQQGDVKTGAMKNLLAPMDTVLNRLVDAGYCAASLHTSVV
ANSVALLYKLFLDSYFKEGNQLLCFQVLPRLFGCLKISHLQEEQSKALSTSDWTTELLVV
EQLLNSVANNNIYNIAADRIRHEEAQFRFYRHVAELLINHAQAPIPAWFRCLKTLISLNH
LILEPDLDDLLASAWIDAEVTEFRTKKAQEALIRTVFQTYAKLRQVPRLFEEVLGVICRP
AAEALRQPVLASGPSTVLSACLLELPPSQILDTWSLVLEKFQSLVLPYLQSDADMALKSL
SLSLLLHCIMFNMRSLDSSTPLPIVRRTQCMMERMMRELVQPLLALLPDTPGPEPELWLQ
KVSDSVLLLSYTWAQVDAMFSLNCSQYHSMSGPLIGVALEISNLPSLLPGVKTQHWKKIE
KFTAQFSSLGTYCLEQLYLQKMKRTLMQTSFRSEGAIQSLRCDAAFIIGSGRKSLNQRTT
ASWDGQVGMVSGLTYPVAHWHLIVSNLTILISYLCPDDVGYLASVLLRTLPMGKAQEVSI
DEEAYITLEKISKAFLHSPLFPEMQSLHSAFLTCVTTSCSSILCSGAQRDSGLVSQQLPW
LFEKDHMVVGHWENRFAKAGPEGIEPRGEIAQNLLSLVKSDFPIQLEGEQLESILGLLEV
ISALQLDSLLPPYHVHYFLVLLSMAVTKLGCSCSSSLALKFLTTCYQLLGYLQKGKSARS
VFKIMYGSDIFEVVLTSLFRASSRFLIEMDDPAWLEFLQVIGTFLEELMQMLIQMKLSLV
LNFRKITAFLSSSKPYTEAASSKQLENQNPQGRQLLLVSLTRLCHVLGPFLKEQKLGQEA
PAALSELLQQVVLQTGAVLQLCSVPGARGWRLPSVLISSVSTLLEADLGQHCRDGGADIS
QGSDRTLLSHVALYQGVYSQILLELPALAGHDQSFQAALQFLTLFFLAPELHPKKDSVFT
SMFHSVRRVLADPEIPVQVTQDIEPHLGALFTQMLEVGTTEDLRLVMQCILQGLDVSNMW
KADVQAVVSAVTLLRLLLNCPLSGEKASLLWRACPQIVTALTLLNREASQEQPVSLTVVG
PVLDVLAALLRQGEEAIGNPHHVSLAFSILLTVPLDHLKPLEYGSVFPRLHNVLFSILQC
HPKVMLKAIPSFLNSFNRLVFSVMREGRQKDKGSIDDLPTVLKCARLVERMYSHIAARAE
EFAVFSPFMVAQYVLEVQKVTLYPAVKSLLQEGIYLILDLCIEPDVQFLRASLQPGMRDI
FKELYNDYLKYHKAKHEGEKRYTA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14146	1.000	1.000	0.000	1524	1.000	1.000	Q14146.pdb.gz	URB2_HUMAN Unhealthy ribosome biogenesis protein 2 homolog OS=Homo sapiens OX=9606 GN=URB2 PE=1 SV=2
2	AFDB:A0A286YB81	0.864	0.843	1.570E-77	1565	0.368	0.358	A0A286YB81.pdb.gz
3	AFDB:Q09804	0.496	0.557	1.651E-17	1318	0.125	0.145	Q09804.pdb.gz	URB2_SCHPO Probable nucleolar pre-ribosomal-associated protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=urb2 PE=3 SV=2
4	AFDB:Q4V906	0.153	0.664	1.255E-13	338	0.084	0.379	Q4V906.pdb.gz
5	AFDB:P47108	0.380	0.455	2.789E-11	1174	0.121	0.157	P47108.pdb.gz	URB2_YEAST Nucleolar pre-ribosomal-associated protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=URB2 PE=1 SV=1
6	AFDB:Q8L5Y6	0.168	0.194	2.153E-10	1219	0.099	0.124	Q8L5Y6.pdb.gz	CAND1_ARATH Cullin-associated NEDD8-dissociated protein 1 OS=Arabidopsis thaliana OX=3702 GN=CAND1 PE=1 SV=1
7	AFDB:A0A2R8QID6	0.136	0.103	1.023E-9	2263	0.150	0.101	A0A2R8QID6.pdb.gz
8	PDB:7mq8LM	0.109	0.090	2.711E-9	2005	0.146	0.111	7mq8LM.pdb.gz	Nucleolar maturation of the human small subunit processome.
9	AFDB:F4I718	0.094	0.078	3.439E-9	2136	0.157	0.112	F4I718.pdb.gz	CSI3_ARATH Protein CELLULOSE SYNTHASE INTERACTIVE 3 OS=Arabidopsis thaliana OX=3702 GN=CSI3 PE=1 SV=1
10	PDB:7mqaLM	0.110	0.088	4.252E-9	2041	0.140	0.105	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
11	AFDB:Q9P3A8	0.178	0.203	5.395E-9	1220	0.111	0.139	Q9P3A8.pdb.gz	CAND1_SCHPO Cullin-associated NEDD8-dissociated protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=knd1 PE=3 SV=1
12	AFDB:O60287	0.163	0.123	6.415E-9	2271	0.157	0.106	O60287.pdb.gz	NPA1P_HUMAN Nucleolar pre-ribosomal-associated protein 1 OS=Homo sapiens OX=9606 GN=URB1 PE=1 SV=4
13	PDB:7tzcA	0.167	0.086	3.398E-8	4404	0.145	0.050	7tzcA.pdb.gz	A drug and ATP binding site in type 1 ryanodine receptor.
14	PDB:7jq9A	0.259	0.192	4.805E-8	2427	0.138	0.087	7jq9A.pdb.gz
15	PDB:6xu2A	0.198	0.253	5.519E-8	1091	0.101	0.141	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
16	PDB:7mqaSP	0.103	0.081	7.033E-8	2485	0.140	0.086	7mqaSP.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:7mopA	0.256	0.186	9.278E-8	2445	0.147	0.092	7mopA.pdb.gz	Solenoid architecture of HUWE1 contributes to ligase activity and substrate recognition.
18	PDB:7ni5A	0.126	0.090	9.605E-8	2791	0.135	0.074	7ni5A.pdb.gz	Molecular basis of human ATM kinase inhibition.
19	PDB:7pgsN	0.129	0.118	1.142E-7	1787	0.129	0.110	7pgsN.pdb.gz	The structure of neurofibromin isoform 2 reveals different functional states.
20	PDB:7ajuUT	0.115	0.094	1.731E-7	2313	0.138	0.091	7ajuUT.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B0V0U5	0.0	910	1495	0.373	0.381	URB2_DANRE Unhealthy ribosome biogenesis protein 2 homolog OS=Danio rerio OX=7955 GN=urb2 PE=2 SV=1
2	Q14146	0.0	3110	1524	1.000	1.000	URB2_HUMAN Unhealthy ribosome biogenesis protein 2 homolog OS=Homo sapiens OX=9606 GN=URB2 PE=1 SV=2
3	B0V0U6	2.16e-66	230	326	0.073	0.344	B0V0U6_DANRE Unhealthy ribosome biogenesis protein 2 homolog OS=Danio rerio OX=7955 GN=fc13e02 PE=1 SV=1
4	Q89VT8	0.74	36.6	326	0.023	0.107	AACL1_BRADU Amino acid--[acyl-carrier-protein] ligase 1 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110) OX=224911 GN=bll0957 PE=1 SV=1
5	X5ICX9	5.3	34.3	2404	0.010	0.007	X5ICX9_9POTY Polyprotein OS=Wheat yellow mosaic virus OX=75746 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10441 Urb2	2e-20	85.2	Urb2/Npa2 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000258243

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000372199	0.949	Nucleolar pre-ribosomal-associated protein 1
2	9606.ENSP00000441140	0.758	Nucleolar protein 8
3	9606.ENSP00000331209	0.679	Ester hydrolase C11orf54
4	9606.ENSP00000324729	0.676	Protein salvador homolog 1
5	9606.ENSP00000244520	0.649	U1 small nuclear ribonucleoprotein C
6	9606.ENSP00000368970	0.636	Ubiquitin-fold modifier 1
7	9606.ENSP00000296792	0.612	U3 small nucleolar RNA-associated protein 15 homolog
8	9606.ENSP00000322396	0.610	Ribosome biogenesis regulatory protein homolog
9	9606.ENSP00000353246	0.579	Protein MAK16 homolog
10	9606.ENSP00000254940	0.546	60S ribosome subunit biogenesis protein NIP7 homolog
11	9606.ENSP00000253107	0.508	Suppressor of SWI4 1 homolog
12	9606.ENSP00000308179	0.508	WD repeat-containing protein 3
13	9606.ENSP00000431459	0.506	Leucine repeat adapter protein 25
14	9606.ENSP00000228506	0.504	Malectin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.779	organic cyclic compound binding
GO:1901363	0.762	heterocyclic compound binding
GO:0003676	0.738	nucleic acid binding
GO:0003723	0.555	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.985	regulation of cellular process
GO:2000736	0.783	regulation of stem cell differentiation
GO:1902036	0.738	regulation of hematopoietic stem cell differentiation
GO:0009987	0.467	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005730	1.000	nucleolus
GO:0030496	0.998	midbody
GO:0016234	0.997	inclusion body
GO:0016235	0.985	aggresome
GO:0005654	0.934	nucleoplasm
GO:0005737	0.843	cytoplasm
GO:0005829	0.460	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]