StarFunc result for job id Q14147

User Input

>input (1143 residues)
MPPPRTREGRDRRDHHRAPSEEEALEKWDWNCPETRRLLEDAFFREEDYIRQGSEECQKF
WTFFERLQRFQNLKTSRKEEKDPGQPKHSIPALADLPRTYDPRYRINLSVLGPATRGSQG
LGRHLPAERVAEFRRALLHYLDFGQKQAFGRLAKLQRERAALPIAQYGNRILQTLKEHQV
VVVAGDTGCGKSTQVPQYLLAAGFSHVACTQPRRIACISLAKRVGFESLSQYGSQVGYQI
RFESTRSAATKIVFLTVGLLLRQIQREPSLPQYEVLIVDEVHERHLHNDFLLGVLQRLLP
TRPDLKVILMSATINISLFSSYFSNAPVVQVPGRLFPITVVYQPQEAEPTTSKSEKLDPR
PFLRVLESIDHKYPPEERGDLLVFLSGMAEISAVLEAAQTYASHTQRWVVLPLHSALSVA
DQDKVFDVAPPGVRKCILSTNIAETSVTIDGIRFVVDSGKVKEMSYDPQAKLQRLQEFWI
SQASAEQRKGRAGRTGPGVCFRLYAESDYDAFAPYPVPEIRRVALDSLVLQMKSMSVGDP
RTFPFIEPPPPASLETAILYLRDQGALDSSEALTPIGSLLAQLPVDVVIGKMLILGSMFS
LVEPVLTIAAALSVQSPFTRSAQSSPECAAARRPLESDQGDPFTLFNVFNAWVQVKSERS
RNSRKWCRRRGIEEHRLYEMANLRRQFKELLEDHGLLAGAQAAQVGDSYSRLQQRRERRA
LHQLKRQHEEGAGRRRKVLRLQEEQDGGSSDEDRAGPAPPGASDGVDIQDVKFKLRHDLA
QLQAAASSAQDLSREQLALLKLVLGRGLYPQLAVPDAFNSSRKDSDQIFHTQAKQGAVLH
PTCVFAGSPEVLHAQELEASNCDGSRDDKDKMSSKHQLLSFVSLLETNKPYLVNCVRIPA
LQSLLLFSRSLDTNGDCSRLVADGWLELQLADSESAIRLLAASLRLRARWESALDRQLAH
QAQQQLEEEEEDTPVSPKEVATLSKELLQFTASKIPYSLRRLTGLEVQNMYVGPQTIPAT
PHLPGLFGSSTLSPHPTKGGYAVTDFLTYNCLTNDTDLYSDCLRTFWTCPHCGLHAPLTP
LERIAHENTCPQAPQDGPPGAEEAALETLQKTSVLQRPYHCEACGKDFLFTPTEVLRHRK
QHV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A286YAG0	0.881	0.873	0.000	1154	0.597	0.591	A0A286YAG0.pdb.gz
2	AFDB:Q14147	1.000	1.000	0.000	1143	1.000	1.000	Q14147.pdb.gz	DHX34_HUMAN Probable ATP-dependent RNA helicase DHX34 OS=Homo sapiens OX=9606 GN=DHX34 PE=1 SV=2
3	AFDB:U4PRA5	0.727	0.761	1.066E-83	1089	0.347	0.365	U4PRA5.pdb.gz	U4PRA5_CAEEL ATP-dependent RNA helicase DHX34 OS=Caenorhabditis elegans OX=6239 GN=smgl-2 PE=1 SV=1
4	AFDB:F4ILR7	0.532	0.604	8.011E-58	995	0.251	0.288	F4ILR7.pdb.gz	DEXH1_ARATH DExH-box ATP-dependent RNA helicase DExH1 OS=Arabidopsis thaliana OX=3702 GN=At2g35920 PE=2 SV=1
5	AFDB:Q382X0	0.582	0.516	1.158E-55	1299	0.234	0.206	Q382X0.pdb.gz	Q382X0_TRYB2 RNA helicase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.3930 PE=4 SV=1
6	AFDB:F4HYJ6	0.574	0.545	9.420E-55	1206	0.242	0.230	F4HYJ6.pdb.gz	F4HYJ6_ARATH RNA helicase OS=Arabidopsis thaliana OX=3702 GN=At1g48650 PE=1 SV=1
7	AFDB:Q7Z478	0.590	0.495	1.262E-54	1369	0.238	0.199	Q7Z478.pdb.gz	DHX29_HUMAN ATP-dependent RNA helicase DHX29 OS=Homo sapiens OX=9606 GN=DHX29 PE=1 SV=2
8	AFDB:Q6P158	0.580	0.481	1.391E-54	1386	0.246	0.203	Q6P158.pdb.gz	DHX57_HUMAN Putative ATP-dependent RNA helicase DHX57 OS=Homo sapiens OX=9606 GN=DHX57 PE=1 SV=2
9	AFDB:Q9HYU6	0.497	0.430	1.445E-53	1326	0.216	0.186	Q9HYU6.pdb.gz	Q9HYU6_PSEAE Probable ATP-dependent helicase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA3297 PE=4 SV=1
10	AFDB:Q8SWT2	0.555	0.667	3.438E-52	942	0.231	0.280	Q8SWT2.pdb.gz	Q8SWT2_DROME GH12763p OS=Drosophila melanogaster OX=7227 GN=Rhau PE=1 SV=1
11	PDB:5n9dB	0.539	0.701	5.033E-46	866	0.216	0.285	5n9dB.pdb.gz	Molecular Mechanistic Insights into Drosophila DHX36-Mediated G-Quadruplex Unfolding: A Structure-Based Model.
12	PDB:5aorA	0.547	0.616	6.353E-45	1009	0.203	0.230	5aorA.pdb.gz	Structure of the RNA Helicase Mle Reveals the Molecular Mechanisms for Uridine Specificity and RNA-ATP Coupling.
13	PDB:6id1V	0.498	0.844	8.937E-45	663	0.202	0.348	6id1V.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
14	PDB:7dcpx	0.486	0.807	1.257E-44	670	0.185	0.315	7dcpx.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
15	PDB:5xjcY	0.486	0.765	3.500E-44	713	0.200	0.321	5xjcY.pdb.gz	An Atomic Structure of the Human Spliceosome
16	PDB:6ff7q	0.482	0.855	1.023E-43	625	0.198	0.362	6ff7q.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
17	PDB:5vheA	0.559	0.724	1.439E-43	871	0.213	0.279	5vheA.pdb.gz	Structural basis of G-quadruplex unfolding by the DEAH/RHA helicase DHX36.
18	PDB:3kx2B	0.494	0.732	2.344E-43	755	0.192	0.291	3kx2B.pdb.gz	Structural basis for the function of DEAH helicases
19	PDB:5ylzW	0.491	0.781	5.058E-42	703	0.181	0.294	5ylzW.pdb.gz	Structure of the Post-catalytic Spliceosome from Saccharomyces cerevisiae
20	PDB:6h57A	0.417	0.564	4.116E-41	795	0.206	0.296	6h57A.pdb.gz	The DEAH-box RNA helicase Dhr1 contains a remarkable carboxyl terminal domain essential for small ribosomal subunit biogenesis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2BIE5	0.0	1332	1150	0.600	0.597	A2BIE5_DANRE DEAH (Asp-Glu-Ala-His) box polypeptide 34 OS=Danio rerio OX=7955 GN=si:ch211-255l12.1 PE=1 SV=2
2	Q14147	0.0	2342	1143	1.000	1.000	DHX34_HUMAN Probable ATP-dependent RNA helicase DHX34 OS=Homo sapiens OX=9606 GN=DHX34 PE=1 SV=2
3	U4PRA5	0.0	682	1089	0.330	0.346	U4PRA5_CAEEL ATP-dependent RNA helicase DHX34 OS=Caenorhabditis elegans OX=6239 GN=smgl-2 PE=1 SV=1
4	F4ILR7	1.69e-124	409	995	0.206	0.237	DEXH1_ARATH DExH-box ATP-dependent RNA helicase DExH1 OS=Arabidopsis thaliana OX=3702 GN=At2g35920 PE=2 SV=1
5	F5H658	2.25e-118	396	1181	0.194	0.188	F5H658_HUMAN RNA helicase OS=Homo sapiens OX=9606 GN=DHX8 PE=1 SV=1
6	Q86YB2	5.81e-118	396	1220	0.194	0.182	Q86YB2_HUMAN RNA helicase OS=Homo sapiens OX=9606 GN=DHX8 PE=1 SV=2
7	Q14562	6.30e-118	396	1220	0.194	0.182	DHX8_HUMAN ATP-dependent RNA helicase DHX8 OS=Homo sapiens OX=9606 GN=DHX8 PE=1 SV=1
8	O45244	1.91e-117	390	1008	0.185	0.210	DHX16_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-4 OS=Caenorhabditis elegans OX=6239 GN=mog-4 PE=1 SV=2
9	Q38953	4.22e-117	393	1168	0.192	0.188	DEAH5_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5 OS=Arabidopsis thaliana OX=3702 GN=At3g26560 PE=1 SV=2
10	Q10752	8.85e-116	387	1055	0.187	0.203	CDC28_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase-like protein cdc28 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdc28 PE=3 SV=2
11	A1Z9L3	1.29e-115	390	1242	0.193	0.178	DHX8_DROME ATP-dependent RNA helicase DHX8 OS=Drosophila melanogaster OX=7227 GN=pea PE=1 SV=1
12	Q09530	3.13e-115	388	1200	0.193	0.184	MOG5_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-5 OS=Caenorhabditis elegans OX=6239 GN=mog-5 PE=1 SV=1
13	Q8SWT2	8.14e-115	381	942	0.193	0.235	Q8SWT2_DROME GH12763p OS=Drosophila melanogaster OX=7227 GN=Rhau PE=1 SV=1
14	F4K2E9	3.65e-113	384	1255	0.181	0.165	PRP16_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH7 OS=Arabidopsis thaliana OX=3702 GN=CUV PE=1 SV=1
15	Q7ZVV8	1.69e-112	377	1054	0.190	0.206	Q7ZVV8_DANRE RNA helicase OS=Danio rerio OX=7955 GN=zgc:55590 PE=1 SV=1
16	Q9VIZ3	2.75e-112	373	894	0.178	0.227	Q9VIZ3_DROME LD25692p OS=Drosophila melanogaster OX=7227 GN=l(2)37Cb PE=1 SV=1
17	O42643	5.74e-112	379	1168	0.180	0.176	PRP22_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase prp22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=prp22 PE=1 SV=1
18	F4IJV4	2.68e-111	374	1044	0.179	0.196	DEAH6_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH6 OS=Arabidopsis thaliana OX=3702 GN=MEE29 PE=2 SV=1
19	Q8VY00	5.66e-111	373	1044	0.184	0.201	ESP3_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH1 OS=Arabidopsis thaliana OX=3702 GN=ESP3 PE=1 SV=1
20	O22899	1.25e-110	364	729	0.192	0.300	PRP43_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH3 OS=Arabidopsis thaliana OX=3702 GN=At2g47250 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13401 AAA_22	27	16.4	AAA domain
2	PF00005 ABC_tran	5.9e+02	12.4	ABC transporter
3	PF00270 DEAD	0.03	25.6	DEAD/DEAH box helicase
4	PF04408 HA2	1.3e-12	59.2	Helicase associated domain (HA2)
5	PF00271 Helicase_C	5.9e-08	44.4	Helicase conserved C-terminal domain
6	PF07717 OB_NTP_bind	6.4e-08	44.2	Oligonucleotide/oligosaccharide-binding (OB)-fold
7	PF00437 T2SSE	5.2e+02	11.0	Type II/IV secretion system protein
8	PF02367 TsaE	5.6e+02	11.9	Threonylcarbamoyl adenosine biosynthesis protein TsaE

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000331907

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000281513	0.880	Neuroblastoma-amplified sequence
2	9606.ENSP00000270066	0.862	Protein SMG9
3	9606.ENSP00000247003	0.855	Probable ATP-dependent RNA helicase DDX49
4	9606.ENSP00000470142	0.845	Regulator of nonsense transcripts 1
5	9606.ENSP00000438748	0.838	Protein SMG8
6	9606.ENSP00000362153	0.837	Nucleolar GTP-binding protein 2
7	9606.ENSP00000364448	0.817	Regulator of nonsense transcripts 3A
8	9606.ENSP00000348708	0.814	Regulator of nonsense transcripts 2
9	9606.ENSP00000263073	0.804	Telomerase-binding protein EST1A
10	9606.ENSP00000276201	0.776	Regulator of nonsense transcripts 3B
11	9606.ENSP00000402515	0.749	Serine/threonine-protein kinase SMG1
12	9606.ENSP00000269349	0.741	Eukaryotic initiation factor 4A-III
13	9606.ENSP00000355261	0.735	Protein SMG5
14	9606.ENSP00000323858	0.729	ATP-dependent RNA helicase DDX54
15	9606.ENSP00000425133	0.723	Protein SMG7
16	9606.ENSP00000264645	0.691	Protein CASC3
17	9606.ENSP00000360532	0.686	Cell division cycle 5-like protein
18	9606.ENSP00000334840	0.684	Proline-rich nuclear receptor coactivator 2
19	9606.ENSP00000341762	0.679	Binder of sperm protein homolog 1
20	9606.ENSP00000340914	0.677	Synaptotagmin-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003723	0.999	RNA binding
GO:0016887	0.997	ATP hydrolysis activity
GO:0044877	0.859	protein-containing complex binding
GO:0140640	0.569	catalytic activity, acting on a nucleic acid
GO:0140098	0.468	catalytic activity, acting on RNA
GO:0008186	0.346	ATP-dependent activity, acting on RNA
GO:0003724	0.314	RNA helicase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0000956	0.989	nuclear-transcribed mRNA catabolic process
GO:0050794	0.963	regulation of cellular process
GO:0019219	0.951	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.927	regulation of RNA metabolic process
GO:0048518	0.911	positive regulation of biological process
GO:0010604	0.850	positive regulation of macromolecule metabolic process
GO:1903311	0.772	regulation of mRNA metabolic process
GO:0061013	0.716	regulation of mRNA catabolic process
GO:1902369	0.675	negative regulation of RNA catabolic process
GO:1903312	0.621	negative regulation of mRNA metabolic process
GO:0010628	0.576	positive regulation of gene expression
GO:0048522	0.482	positive regulation of cellular process
GO:0010467	0.443	gene expression
GO:0031325	0.390	positive regulation of cellular metabolic process
GO:0006397	0.326	mRNA processing
GO:1902373	0.312	negative regulation of mRNA catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.998	cellular anatomical entity
GO:0005634	0.966	nucleus
GO:0016020	0.954	membrane
GO:0031981	0.949	nuclear lumen
GO:0005654	0.938	nucleoplasm
GO:0043232	0.866	intracellular non-membrane-bounded organelle
GO:0005829	0.726	cytosol
GO:0005730	0.501	nucleolus
GO:0032991	0.349	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:13065	0.997	ATP + H2O = ADP + H(+) + phosphate
EC:3.6.4.13	0.314	RNA helicase.

[back to server]