StarFunc result for job id Q14152

User Input

>input (1382 residues)
MPAYFQRPENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVD
LRKSHLAKEGLYQYKNICQQVNIKSLEDVVRAYLKMAEEKTEAAKEESQQMVLDIEDLDN
IQTPESVLLSAVSGEDTQDRTDRLLLTPWVKFLWESYRQCLDLLRNNSRVERLYHDIAQQ
AFKFCLQYTRKAEFRKLCDNLRMHLSQIQRHHNQSTAINLNNPESQSMHLETRLVQLDSA
ISMELWQEAFKAVEDIHGLFSLSKKPPKPQLMANYYNKVSTVFWKSGNALFHASTLHRLY
HLSREMRKNLTQDEMQRMSTRVLLATLSIPITPERTDIARLLDMDGIIVEKQRRLATLLG
LQAPPTRIGLINDMVRFNVLQYVVPEVKDLYNWLEVEFNPLKLCERVTKVLNWVREQPEK
EPELQQYVPQLQNNTILRLLQQVSQIYQSIEFSRLTSLVPFVDAFQLERAIVDAARHCDL
QVRIDHTSRTLSFGSDLNYATREDAPIGPHLQSMPSEQIRNQLTAMSSVLAKALEVIKPA
HILQEKEEQHQLAVTAYLKNSRKEHQRILARRQTIEERKERLESLNIQREKEELEQREAE
LQKVRKAEEERLRQEAKEREKERILQEHEQIKKKTVRERLEQIKKTELGAKAFKDIDIED
LEELDPDFIMAKQVEQLEKEKKELQERLKNQEKKIDYFERAKRLEEIPLIKSAYEEQRIK
DMDLWEQQEEERITTMQLEREKALEHKNRMSRMLEDRDLFVMRLKAARQSVYEEKLKQFE
ERLAEERHNRLEERKRQRKEERRITYYREKEEEEQRRAEEQMLKEREERERAERAKREEE
LREYQERVKKLEEVERKKRQRELEIEERERRREEERRLGDSSLSRKDSRWGDRDSEGTWR
KGPEADSEWRRGPPEKEWRRGEGRDEDRSHRRDEERPRRLGDDEDREPSLRPDDDRVPRR
GMDDDRGPRRGPEEDRFSRRGADDDRPSWRNTDDDRPPRRIADEDRGNWRHADDDRPPRR
GLDEDRGSWRTADEDRGPRRGMDDDRGPRRGGADDERSSWRNADDDRGPRRGLDDDRGPR
RGMDDDRGPRRGMDDDRGPRRGMDDDRGPRRGLDDDRGPWRNADDDRIPRRGAEDDRGPW
RNMDDDRLSRRADDDRFPRRGDDSRPGPWRPLVKPGGWREKEKAREESWGPPRESRPSEE
REWDREKERDRDNQDREENDKDPERERDRERDVDREDRFRRPRDEGGWRRGPAEESSSWR
DSSRRDDRDRDDRRRERDDRRDLRERRDLRDDRDRRGPPLRSEREEVSSWRRADDRKDDR
VEERDPPRRVPPPALSRDRERDRDREREGEKEKASWRAEKDRESLRRTKNETDEDGWTTV
RR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14152	1.000	1.000	0.000	1382	1.000	1.000	Q14152.pdb.gz	EIF3A_HUMAN Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens OX=9606 GN=EIF3A PE=1 SV=1
2	AFDB:Q1JU68	0.509	0.519	0.000	1354	0.931	0.950	Q1JU68.pdb.gz	EIF3A_RAT Eukaryotic translation initiation factor 3 subunit A OS=Rattus norvegicus OX=10116 GN=Eif3a PE=2 SV=2
3	PDB:6zmwu	0.392	0.747	2.807E-68	706	0.508	0.994	6zmwu.pdb.gz	Structure of a human 48Stranslational initiation complex.
4	AFDB:Q9VN25	0.451	0.541	9.507E-66	1140	0.380	0.461	Q9VN25.pdb.gz	EIF3A_DROME Eukaryotic translation initiation factor 3 subunit A OS=Drosophila melanogaster OX=7227 GN=eIF3a PE=1 SV=1
5	AFDB:P34339	0.401	0.510	7.439E-56	1076	0.279	0.359	P34339.pdb.gz	EIF3A_CAEEL Eukaryotic translation initiation factor 3 subunit A OS=Caenorhabditis elegans OX=6239 GN=egl-45 PE=3 SV=1
6	PDB:6fyxo	0.293	0.724	2.388E-22	529	0.113	0.295	6fyxo.pdb.gz	Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
7	PDB:5mpbP	0.210	0.535	4.414E-8	440	0.061	0.191	5mpbP.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
8	PDB:5l4kP	0.211	0.517	1.182E-7	456	0.051	0.154	5l4kP.pdb.gz
9	PDB:5l4kQ	0.147	0.367	1.013E-6	422	0.044	0.145	5l4kQ.pdb.gz
10	PDB:5mpbQ	0.155	0.376	3.390E-6	434	0.040	0.127	5mpbQ.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
11	PDB:5gjqP	0.196	0.531	3.545E-6	413	0.048	0.160	5gjqP.pdb.gz	An atomic structure of the human 26S proteasome.
12	PDB:6r7nB	0.162	0.392	5.304E-6	443	0.047	0.147	6r7nB.pdb.gz	Structural basis of Cullin 2 RING E3 ligase regulation by the COP9 signalosome.
13	PDB:5l4kO	0.141	0.394	9.925E-6	376	0.041	0.149	5l4kO.pdb.gz
14	PDB:3jckF	0.141	0.357	1.085E-5	388	0.039	0.139	3jckF.pdb.gz	Atomic structure of the 26S proteasome lid reveals the mechanism of deubiquitinase inhibition.
15	AFDB:A0A166B1A6	0.057	0.066	2.742E-4	1119	0.140	0.172	A0A166B1A6.pdb.gz	NMCP1_DAUCS Nuclear matrix constituent protein 1 OS=Daucus carota subsp. sativus OX=79200 GN=NMCP1 PE=1 SV=2
16	AFDB:Q9CA42	0.057	0.071	4.289E-4	1085	0.153	0.195	Q9CA42.pdb.gz	CRWN3_ARATH Protein CROWDED NUCLEI 3 OS=Arabidopsis thaliana OX=3702 GN=CRWN3 PE=1 SV=1
17	AFDB:F4HRT5	0.059	0.068	6.136E-4	1132	0.154	0.188	F4HRT5.pdb.gz	CRWN1_ARATH Protein CROWDED NUCLEI 1 OS=Arabidopsis thaliana OX=3702 GN=CRWN1 PE=1 SV=1
18	AFDB:Q9CS72	0.047	0.052	2.754E-2	1211	0.130	0.149	Q9CS72.pdb.gz	FLIP1_MOUSE Filamin-A-interacting protein 1 OS=Mus musculus OX=10090 GN=Filip1 PE=1 SV=3
19	AFDB:P12036	0.051	0.065	5.154E-2	1026	0.094	0.127	P12036.pdb.gz	NFH_HUMAN Neurofilament heavy polypeptide OS=Homo sapiens OX=9606 GN=NEFH PE=1 SV=4
20	AFDB:Q6NRG6	0.052	0.095	5.637E-2	668	0.075	0.154	Q6NRG6.pdb.gz	SAS6_XENLA Spindle assembly abnormal protein 6 homolog OS=Xenopus laevis OX=8355 GN=sas6 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P23116	0.0	2204	1344	0.918	0.943	EIF3A_MOUSE Eukaryotic translation initiation factor 3 subunit A OS=Mus musculus OX=10090 GN=Eif3a PE=1 SV=5
2	Q14152	0.0	2737	1382	1.000	1.000	EIF3A_HUMAN Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens OX=9606 GN=EIF3A PE=1 SV=1
3	Q1JU68	0.0	2200	1354	0.920	0.939	EIF3A_RAT Eukaryotic translation initiation factor 3 subunit A OS=Rattus norvegicus OX=10116 GN=Eif3a PE=2 SV=2
4	Q9VN25	0.0	800	1140	0.376	0.456	EIF3A_DROME Eukaryotic translation initiation factor 3 subunit A OS=Drosophila melanogaster OX=7227 GN=eIF3a PE=1 SV=1
5	P34339	1.29e-180	566	1076	0.240	0.308	EIF3A_CAEEL Eukaryotic translation initiation factor 3 subunit A OS=Caenorhabditis elegans OX=6239 GN=egl-45 PE=3 SV=1
6	Q9LD55	9.84e-166	524	987	0.229	0.320	EIF3A_ARATH Eukaryotic translation initiation factor 3 subunit A OS=Arabidopsis thaliana OX=3702 GN=TIF3A1 PE=1 SV=1
7	O74760	1.06e-147	474	932	0.233	0.345	EIF3A_SCHPO Eukaryotic translation initiation factor 3 subunit A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tif32 PE=1 SV=1
8	P38249	2.29e-85	303	964	0.185	0.266	EIF3A_YEAST Eukaryotic translation initiation factor 3 subunit A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPG1 PE=1 SV=1
9	Q4G0P3	1.28e-08	62.4	5121	0.056	0.015	HYDIN_HUMAN Hydrocephalus-inducing protein homolog OS=Homo sapiens OX=9606 GN=HYDIN PE=1 SV=3
10	M9PHD8	1.78e-04	48.9	1714	0.024	0.019	M9PHD8_DROME TATA box-binding protein-like 1 OS=Drosophila melanogaster OX=7227 GN=Trf2 PE=3 SV=1
11	Q07DP5	1.84e-04	48.5	1715	0.024	0.019	Q07DP5_DROME TATA box-binding protein-like 1 OS=Drosophila melanogaster OX=7227 GN=Trf2 PE=2 SV=1
12	Q8SX83	0.004	44.7	5560	0.018	0.004	SPEN_DROME Protein split ends OS=Drosophila melanogaster OX=7227 GN=spen PE=1 SV=2
13	F4J0L7	0.073	40.0	2156	0.028	0.018	F4J0L7_ARATH Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=At3g50370 PE=1 SV=1
14	Q9VJ87	0.086	40.0	1330	0.041	0.043	CWC22_DROME Pre-mRNA-splicing factor CWC22 homolog OS=Drosophila melanogaster OX=7227 GN=ncm PE=1 SV=3
15	F4JW79	0.13	39.3	1493	0.048	0.045	RDM3_ARATH Protein RNA-directed DNA methylation 3 OS=Arabidopsis thaliana OX=3702 GN=RDM3 PE=1 SV=1
16	Q5HZI1	0.28	38.1	1210	0.040	0.045	MTUS1_MOUSE Microtubule-associated tumor suppressor 1 homolog OS=Mus musculus OX=10090 GN=Mtus1 PE=1 SV=2
17	Q8IDX6	0.50	37.4	3130	0.033	0.014	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
18	A1Z7Z9	0.56	37.4	1134	0.043	0.053	CP131_DROME Centrosomal protein of 131 kDa OS=Drosophila melanogaster OX=7227 GN=dila PE=2 SV=2
19	Q582N9	1.1	36.2	1063	0.048	0.063	Q582N9_TRYB2 T. brucei spp.-specific protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.48K5.740 PE=4 SV=1
20	A0A0R4IVY5	2.5	35.0	1359	0.039	0.040	A0A0R4IVY5_DANRE Rho-associated protein kinase OS=Danio rerio OX=7955 GN=rock1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01399 PCI	3.9e-20	83.7	PCI domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358140

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216190	0.999	Eukaryotic translation initiation factor 3 subunit D
2	9606.ENSP00000216554	0.999	Eukaryotic translation initiation factor 5
3	9606.ENSP00000220849	0.999	Eukaryotic translation initiation factor 3 subunit E
4	9606.ENSP00000248342	0.999	Eukaryotic translation initiation factor 3 subunit K
5	9606.ENSP00000253039	0.999	Eukaryotic translation initiation factor 2 subunit 3
6	9606.ENSP00000253108	0.999	Eukaryotic translation initiation factor 3 subunit G
7	9606.ENSP00000256383	0.999	Eukaryotic translation initiation factor 2 subunit 1
8	9606.ENSP00000261868	0.999	Eukaryotic translation initiation factor 3 subunit J
9	9606.ENSP00000332604	0.999	Eukaryotic translation initiation factor 3 subunit C
10	9606.ENSP00000354125	0.999	Eukaryotic translation initiation factor 3 subunit B
11	9606.ENSP00000362688	0.999	Eukaryotic translation initiation factor 3 subunit I
12	9606.ENSP00000364119	0.999	Eukaryotic translation initiation factor 2 subunit 2
13	9606.ENSP00000368927	0.999	Eukaryotic translation initiation factor 1A, X-chromosomal
14	9606.ENSP00000370258	0.999	Eukaryotic translation initiation factor 3 subunit C-like protein
15	9606.ENSP00000419449	0.999	Eukaryotic translation initiation factor 1
16	9606.ENSP00000429931	0.999	Eukaryotic translation initiation factor 3 subunit H
17	9606.ENSP00000431800	0.999	Eukaryotic translation initiation factor 3 subunit F
18	9606.ENSP00000436049	0.999	Eukaryotic translation initiation factor 3 subunit M
19	9606.ENSP00000485663	0.999	Eukaryotic translation initiation factor 3 subunit L
20	9606.ENSP00000293831	0.997	Eukaryotic initiation factor 4A-I

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003743	1.000	translation initiation factor activity
GO:0003723	0.999	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:0034641	0.996	cellular nitrogen compound metabolic process
GO:1901564	0.995	organonitrogen compound metabolic process
GO:0010467	0.995	gene expression
GO:0006412	0.991	translation
GO:0006413	0.984	translational initiation
GO:0002181	0.964	cytoplasmic translation
GO:0002183	0.938	cytoplasmic translational initiation
GO:0071840	0.880	cellular component organization or biogenesis
GO:0022613	0.841	ribonucleoprotein complex biogenesis
GO:0016043	0.813	cellular component organization
GO:0065007	0.741	biological regulation
GO:0050789	0.734	regulation of biological process
GO:0050794	0.721	regulation of cellular process
GO:0022607	0.684	cellular component assembly
GO:0022618	0.652	ribonucleoprotein complex assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043232	0.997	intracellular non-membrane-bounded organelle
GO:0031981	0.996	nuclear lumen
GO:0032991	0.995	protein-containing complex
GO:0005654	0.991	nucleoplasm
GO:0005829	0.988	cytosol
GO:0016020	0.987	membrane
GO:0005730	0.850	nucleolus
GO:0005852	0.429	eukaryotic translation initiation factor 3 complex
GO:0005856	0.413	cytoskeleton
GO:0070062	0.403	extracellular exosome
GO:0099080	0.397	supramolecular complex
GO:0012505	0.397	endomembrane system
GO:0099081	0.322	supramolecular polymer

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]