StarFunc result for job id Q14153

User Input

>input (422 residues)
MVMVLSESLSTRGADSIACGTFSRELHTPKKMSQGPTLFSCGIMENDRWRDLDRKCPLQI
DQPSTSIWECLPEKDSSLWHREAVTACAVTSLIKDLSISDHNGNPSAPPSKRQCRSLSFS
DEMSSCRTSWRPLGSKVWTPVEKRRCYSGGSVQRYSNGFSTMQRSSSFSLPSRANVLSSP
CDQAGLHHRFGGQPCQGVPGSAPCGQAGDTWSPDLHPVGGGRLDLQRSLSCSHEQFSFVE
YCPPSANSTPASTPELARRSSGLSRSRSQPCVLNDKKVGVKRRRPEEVQEQRPSLDLAKM
AQNCQTFSSLSCLSAGTEDCGPQSPFARHVSNTRAWTALLSASGPGGRTPAGTPVPEPLP
PSFDDHLACQEDLSCEESDSCALDEDCGRRAEPAAAWRDRGAPGNSLCSLDGELDIEQIE
KN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14153	1.000	1.000	4.522E-61	422	1.000	1.000	Q14153.pdb.gz	FA53B_HUMAN Protein FAM53B OS=Homo sapiens OX=9606 GN=FAM53B PE=1 SV=2
2	AFDB:Q59VM4	0.076	0.064	8.830E-1	536	0.123	0.097	Q59VM4.pdb.gz	RPN4_CANAL Transcriptional regulator RPN4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RPN4 PE=1 SV=1
3	AFDB:Q8CDG5	0.080	0.054	9.450E-1	640	0.133	0.087	Q8CDG5.pdb.gz	CRERF_MOUSE CREB3 regulatory factor OS=Mus musculus OX=10090 GN=Crebrf PE=2 SV=1
4	AFDB:Q8IWE5	0.063	0.035	2.997	1019	0.166	0.069	Q8IWE5.pdb.gz	PKHM2_HUMAN Pleckstrin homology domain-containing family M member 2 OS=Homo sapiens OX=9606 GN=PLEKHM2 PE=1 SV=2
5	AFDB:Q6PFW1	0.069	0.030	4.819	1433	0.164	0.048	Q6PFW1.pdb.gz	VIP1_HUMAN Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 OS=Homo sapiens OX=9606 GN=PPIP5K1 PE=1 SV=1
6	AFDB:Q9V4C8	0.067	0.034	6.323	1500	0.152	0.043	Q9V4C8.pdb.gz	HCF_DROME Host cell factor OS=Drosophila melanogaster OX=7227 GN=Hcf PE=1 SV=2
7	AFDB:Q9JLQ4	0.067	0.048	6.767	704	0.152	0.091	Q9JLQ4.pdb.gz	Q9JLQ4_MOUSE Pleiomorphic adenoma gene-like 1 OS=Mus musculus OX=10090 GN=Plagl1 PE=2 SV=1
8	AFDB:B0ZBF6	0.070	0.035	7.751	984	0.201	0.086	B0ZBF6.pdb.gz	B0ZBF6_HUMAN Mineralocorticoid receptor OS=Homo sapiens OX=9606 GN=NR3C2 PE=4 SV=1
9	AFDB:A9RVK2	0.080	0.050	8.296	764	0.175	0.097	A9RVK2.pdb.gz	M3K1B_PHYPA Mitogen-activated protein kinase kinase kinase 1b OS=Physcomitrium patens OX=3218 GN=MEKK1b PE=2 SV=2
10	AFDB:Q7Z5J4	0.058	0.017	8.878	1906	0.190	0.042	Q7Z5J4.pdb.gz	RAI1_HUMAN Retinoic acid-induced protein 1 OS=Homo sapiens OX=9606 GN=RAI1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14153	0.0	856	422	1.000	1.000	FA53B_HUMAN Protein FAM53B OS=Homo sapiens OX=9606 GN=FAM53B PE=1 SV=2
2	F1QN48	1.95e-65	216	379	0.424	0.472	FA53B_DANRE Protein FAM53B OS=Danio rerio OX=7955 GN=fam53b PE=1 SV=1
3	Q5ZKN5	4.81e-60	202	418	0.372	0.376	FA53A_CHICK Protein FAM53A OS=Gallus gallus OX=9031 GN=FAM53A PE=2 SV=2
4	Q9NYF3	9.37e-13	71.6	392	0.164	0.176	FA53C_HUMAN Protein FAM53C OS=Homo sapiens OX=9606 GN=FAM53C PE=1 SV=1
5	P51866	0.49	35.0	739	0.045	0.026	PECA1_BOVIN Platelet endothelial cell adhesion molecule OS=Bos taurus OX=9913 GN=PECAM1 PE=1 SV=1
6	B8K1W2	2.8	33.1	1325	0.028	0.009	ABCBB_CANLF Bile salt export pump OS=Canis lupus familiaris OX=9615 GN=Abcb11e PE=1 SV=1
7	F7FPV0	3.7	32.3	494	0.040	0.034	F7FPV0_RAT Uridine 5'-monophosphate synthase OS=Rattus norvegicus OX=10116 GN=Umps PE=1 SV=1
8	Q8T867	4.3	32.3	730	0.026	0.015	Q8T867_DICDI DNAJ heat shock N-terminal domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0276447 PE=4 SV=1
9	B5X0E4	4.9	32.0	1255	0.047	0.016	ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus OX=10090 GN=Abcb5 PE=2 SV=1
10	O95342	7.5	31.6	1321	0.026	0.008	ABCBB_HUMAN Bile salt export pump OS=Homo sapiens OX=9606 GN=ABCB11 PE=1 SV=2
11	Q9USH8	7.8	31.2	506	0.057	0.047	GLU2B_SCHPO Glucosidase 2 subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gtb1 PE=1 SV=1
12	P13439	8.7	31.2	481	0.043	0.037	UMPS_MOUSE Uridine 5'-monophosphate synthase OS=Mus musculus OX=10090 GN=Umps PE=1 SV=3
13	Q12053	9.7	31.2	2109	0.097	0.019	AFLC_ASPPU Norsolorinic acid synthase OS=Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1) OX=1403190 GN=aflC PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15242 FAM53	2.4e-116	400.4	Family of FAM53

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000338532

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362047	0.605	XK-related protein 2
2	9606.ENSP00000338860	0.547	Zinc finger protein 444
3	9606.ENSP00000263177	0.545	Phospholipid phosphatase-related protein type 5
4	9606.ENSP00000306425	0.544	Mitochondrial coiled-coil-helix-coiled-coil-helix domain containing proteins
5	9606.ENSP00000357682	0.520	Fibronectin type 3 and ankyrin repeat domains protein 1
6	9606.ENSP00000261531	0.501	SNW domain-containing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0023051	0.996	regulation of signaling
GO:0010646	0.996	regulation of cell communication
GO:0048522	0.987	positive regulation of cellular process
GO:0009966	0.967	regulation of signal transduction
GO:0048584	0.948	positive regulation of response to stimulus
GO:0023056	0.944	positive regulation of signaling
GO:0010647	0.944	positive regulation of cell communication
GO:0009967	0.923	positive regulation of signal transduction
GO:0030111	0.900	regulation of Wnt signaling pathway
GO:0009987	0.840	cellular process
GO:0060828	0.822	regulation of canonical Wnt signaling pathway
GO:0090263	0.802	positive regulation of canonical Wnt signaling pathway
GO:0048519	0.411	negative regulation of biological process
GO:0008152	0.346	metabolic process
GO:0071704	0.335	organic substance metabolic process
GO:0019222	0.317	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.595	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]