StarFunc result for job id Q14154

User Input

>input (515 residues)
MWRLPGLLGRALPRTLGPSLWRVTPKSTSPDGPQTTSSTLLVPVPNLDRSGPHGPGTSGG
PRSHGWKDAFQWMSSRVSPNTLWDAISWGTLAVLALQLARQIHFQASLPAGPQRVEHCSW
HSPLDRFFSSPLWHPCSSLRQHILPSPDGPAPRHTGLREPRLGQEEASAQPRNFSHNSLR
GARPQDPSEEGPGDFGFLHASSSIESEAKPAQPQPTGEKEQDKSKTLSLEEAVTSIQQLF
QLSVSIAFNFLGTENMKSGDHTAAFSYFQKAAARGYSKAQYNAGLCHEHGRGTPRDISKA
VLYYQLAASQGHSLAQYRYARCLLRDPASSWNPERQRAVSLLKQAADSGLREAQAFLGVL
FTKEPYLDEQRAVKYLWLAANNGDSQSRYHLGICYEKGLGVQRNLGEALRCYQQSAALGN
EAAQERLRALFSMGAAAPGPSDLTVTGLKSFSSPSLCSLNTLLAGTSRLPHASSTGNLGL
LCRSGHLGASLEASSRAIPPHPYPLERSVVRLGFG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14154	1.000	1.000	8.364E-64	515	1.000	1.000	Q14154.pdb.gz	DELE1_HUMAN DAP3-binding cell death enhancer 1 OS=Homo sapiens OX=9606 GN=DELE1 PE=1 SV=3
2	AFDB:Q9DCV6	0.641	0.647	8.268E-42	510	0.732	0.739	Q9DCV6.pdb.gz	DELE1_MOUSE DAP3-binding cell death enhancer 1 OS=Mus musculus OX=10090 GN=Dele1 PE=2 SV=1
3	AFDB:A0A0H2VDN9	0.341	0.358	2.934E-9	490	0.113	0.118	A0A0H2VDN9.pdb.gz	ESIB_ECOL6 Secretory immunoglobulin A-binding protein EsiB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=esiB PE=1 SV=1
4	PDB:4bwrA	0.321	0.352	3.594E-9	467	0.113	0.124	4bwrA.pdb.gz	Crystal Structure of C5321: A Protective Antigen Present in Uropathogenic Escherichia Coli Strains Displaying an Slr Fold.
5	AFDB:P77234	0.349	0.543	4.662E-9	325	0.109	0.172	P77234.pdb.gz	YBEQ_ECOLI Sel1-repeat-containing protein YbeQ OS=Escherichia coli (strain K12) OX=83333 GN=ybeQ PE=4 SV=2
6	AFDB:O25001	0.271	0.491	1.958E-8	250	0.068	0.140	O25001.pdb.gz	HCPA_HELPY Beta-lactamase HcpA OS=Helicobacter pylori (strain ATCC 700392 / 26695) OX=85962 GN=hcpA PE=1 SV=1
7	AFDB:Q09897	0.200	0.135	4.301E-8	932	0.188	0.104	Q09897.pdb.gz	CHR3_SCHPO Chitin synthase regulatory factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=chr3 PE=1 SV=1
8	PDB:7mqzA	0.277	0.612	1.477E-6	209	0.066	0.163	7mqzA.pdb.gz
9	AFDB:A0A024R9P6	0.244	0.263	6.765E-5	470	0.124	0.136	A0A024R9P6.pdb.gz
10	AFDB:Q28056	0.193	0.144	1.026E-4	754	0.130	0.089	Q28056.pdb.gz	ASPH_BOVIN Aspartyl/asparaginyl beta-hydroxylase OS=Bos taurus OX=9913 GN=ASPH PE=1 SV=1
11	PDB:1klxA	0.208	0.713	1.513E-4	133	0.058	0.226	1klxA.pdb.gz
12	AFDB:Q3UFM5	0.167	0.121	6.242E-4	854	0.120	0.073	Q3UFM5.pdb.gz	NOM1_MOUSE Nucleolar MIF4G domain-containing protein 1 OS=Mus musculus OX=10090 GN=Nom1 PE=1 SV=2
13	AFDB:F4K0Y5	0.182	0.088	7.172E-4	1165	0.118	0.052	F4K0Y5.pdb.gz	F4K0Y5_ARATH Heat shock protein DnaJ with tetratricopeptide repeat-containing protein OS=Arabidopsis thaliana OX=3702 GN=TPR16 PE=1 SV=1
14	PDB:5udkA	0.220	0.242	7.647E-4	461	0.070	0.078	5udkA.pdb.gz	Structure of human IFIT1 with capped RNA reveals adaptable mRNA binding and mechanisms for sensing N1 and N2 ribose 2'-O methylations.
15	PDB:5w5iC	0.224	0.257	1.333E-3	436	0.062	0.073	5w5iC.pdb.gz	Structural insights into IFIT1 dimerization and conformational changes associated with mRNA binding
16	PDB:4abnB	0.271	0.318	3.690E-3	426	0.076	0.092	4abnB.pdb.gz
17	PDB:7ntfA	0.272	0.162	6.736E-3	918	0.072	0.040	7ntfA.pdb.gz
18	PDB:7kw7E	0.141	0.216	7.055E-3	327	0.083	0.131	7kw7E.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
19	PDB:8a3tD	0.257	0.239	7.389E-3	560	0.062	0.057	8a3tD.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
20	PDB:7dkhI	0.189	0.123	8.490E-3	914	0.058	0.033	7dkhI.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14154	0.0	1044	515	1.000	1.000	DELE1_HUMAN DAP3-binding cell death enhancer 1 OS=Homo sapiens OX=9606 GN=DELE1 PE=1 SV=3
2	Q9DCV6	0.0	693	510	0.732	0.739	DELE1_MOUSE DAP3-binding cell death enhancer 1 OS=Mus musculus OX=10090 GN=Dele1 PE=2 SV=1
3	A0A0H2VDN9	2.01e-13	74.7	490	0.109	0.114	ESIB_ECOL6 Secretory immunoglobulin A-binding protein EsiB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=esiB PE=1 SV=1
4	P77234	3.96e-11	66.6	325	0.115	0.182	YBEQ_ECOLI Sel1-repeat-containing protein YbeQ OS=Escherichia coli (strain K12) OX=83333 GN=ybeQ PE=4 SV=2
5	Q9LM25	5.87e-10	64.3	678	0.107	0.081	HRD3A_ARATH ERAD-associated E3 ubiquitin-protein ligase component HRD3A OS=Arabidopsis thaliana OX=3702 GN=HRD3A PE=1 SV=1
6	A0A1D8PK97	2.57e-09	62.4	751	0.115	0.079	A0A1D8PK97_CANAL Chs4p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CHS4 PE=4 SV=1
7	J9VSG5	2.76e-09	61.6	485	0.140	0.148	SKT5_CRYNH Chitin synthase regulator 2 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CSR2 PE=3 SV=1
8	Q94C27	1.73e-08	58.5	351	0.091	0.134	FB84_ARATH F-box protein At1g70590 OS=Arabidopsis thaliana OX=3702 GN=At1g70590 PE=2 SV=1
9	Q9UBV2	6.25e-08	57.8	794	0.091	0.059	SE1L1_HUMAN Protein sel-1 homolog 1 OS=Homo sapiens OX=9606 GN=SEL1L PE=1 SV=3
10	Q9Z2G6	6.34e-08	57.8	790	0.091	0.059	SE1L1_MOUSE Protein sel-1 homolog 1 OS=Mus musculus OX=10090 GN=Sel1l PE=1 SV=2
11	Q09897	1.20e-07	57.0	932	0.097	0.054	CHR3_SCHPO Chitin synthase regulatory factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=chr3 PE=1 SV=1
12	P34226	1.69e-05	50.1	696	0.142	0.105	SKT5_YEAST Chitin synthase regulator SKT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SKT5 PE=1 SV=1
13	A0A0H3CCF8	3.94e-05	48.5	533	0.066	0.064	A0A0H3CCF8_CAUVN Stalk cross-band protein StpA OS=Caulobacter vibrioides (strain NA1000 / CB15N) OX=565050 GN=stpA PE=1 SV=1
14	G5EFG0	8.44e-05	47.8	685	0.118	0.089	G5EFG0_CAEEL S5 DRBM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sel-1 PE=1 SV=1
15	Q9P2M1	6.32e-04	44.3	347	0.101	0.150	LR2BP_HUMAN LRP2-binding protein OS=Homo sapiens OX=9606 GN=LRP2BP PE=1 SV=2
16	Q07622	0.001	44.3	623	0.128	0.106	ACK1_YEAST Activator of C kinase protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACK1 PE=1 SV=1
17	Q96301	0.003	42.7	914	0.101	0.057	SPY_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Arabidopsis thaliana OX=3702 GN=SPY PE=1 SV=1
18	Q9D4C6	0.003	42.4	346	0.101	0.150	LR2BP_MOUSE LRP2-binding protein OS=Mus musculus OX=10090 GN=Lrp2bp PE=2 SV=1
19	O94614	0.006	41.6	633	0.072	0.058	CHR4_SCHPO Chitin synthase regulatory factor 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=chr4 PE=1 SV=4
20	P39000	0.006	41.6	512	0.039	0.039	SHC1_YEAST Protein SHC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SHC1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08238 Sel1	6.1e-22	88.8	Sel1 repeat
2	PF00515 TPR_1	5.5e+02	11.8	Tetratricopeptide repeat
3	PF07719 TPR_2	1.9e+02	13.6	Tetratricopeptide repeat
4	PF13174 TPR_6	1.2e+02	14.7	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000396225

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000185150	0.641	Endoplasmic reticulum lectin 1
2	9606.ENSP00000318165	0.641	Protein OS-9
3	9606.ENSP00000357320	0.637	28S ribosomal protein S29, mitochondrial
4	9606.ENSP00000430955	0.541	E3 ubiquitin ligase that catalyzes the direct transfer of ubiquitin from E2 ubiquitin-conjugating enzyme to a specific substrate. In response to bacterial infection, negatively regulates the phagocyte oxidative burst by controlling the turnover of the NADPH oxidase complex subunits. Promotes monoubiquitination of CYBA and 'Lys-48'- linked polyubiquitination and degradation of CYBB NADPH oxidase catalytic subunits, both essential for the generation of antimicrobial reactive oxygen species. Involved in the maintenance of cholesterol homeostasis. In response to high sterol concentrations [...]

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019901	1.000	protein kinase binding
GO:0043539	1.000	protein serine/threonine kinase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.990	regulation of cellular process
GO:0050896	0.987	response to stimulus
GO:0030162	0.986	regulation of proteolysis
GO:0006950	0.984	response to stress
GO:0050790	0.975	regulation of catalytic activity
GO:0008625	0.975	extrinsic apoptotic signaling pathway via death domain receptors
GO:0033554	0.973	cellular response to stress
GO:0052547	0.962	regulation of peptidase activity
GO:2000116	0.953	regulation of cysteine-type endopeptidase activity
GO:0043281	0.940	regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0071704	0.590	organic substance metabolic process
GO:0044238	0.568	primary metabolic process
GO:0043170	0.529	macromolecule metabolic process
GO:0006807	0.522	nitrogen compound metabolic process
GO:0044237	0.323	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.998	mitochondrion
GO:0016020	0.990	membrane
GO:0043233	0.923	organelle lumen
GO:0005829	0.906	cytosol
GO:0031090	0.898	organelle membrane
GO:0070013	0.896	intracellular organelle lumen
GO:0031966	0.676	mitochondrial membrane
GO:0005743	0.667	mitochondrial inner membrane
GO:0012505	0.444	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]