StarFunc result for job id Q14155

User Input

>input (803 residues)
MNSAEQTVTWLITLGVLESPKKTISDPEGFLQASLKDGVVLCRLLERLLPGTIEKVYPEP
RSESECLSNIREFLRGCGASLRLELLFPPSQPPQHLVTTILLSASTFDANDLYQGQNFNK
VLSSLVTLNKVTADIGLGSDSVCARPSSHRIKSFDSLGSQSLHTRTSKLFQGQYRSLDMT
DNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVRE
VKASEKPVSPKSGTLKSPPKGFDTTAINKSYYNVVLQNILETENEYSKELQTVLSTYLRP
LQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMKTL
YLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKEL
ERHMEDYHTDRQDIQKSMAAFKNLSAQCQEVRKRKELELQILTEAIRNWEGDDIKTLGNV
TYMSQVLIQCAGSEEKNERYLLLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLEDSE
NHRNAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSH
PVTPSSKHADSKPAPLTPAYHTLPHPSHHGTPHTTINWGPLEPPKTPKPWSLSCLRPAPP
LRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFASRKSTAALEEDAQILKVIEAY
CTSAKTRQTLNSTWQGTDLMHNHVLADDDQPSLDSLGRRSSLSRLEPSDLSEDSDYDSIW
TAHSYRMGSTSRKSCCSYISHQN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14155	1.000	1.000	0.000	803	1.000	1.000	Q14155.pdb.gz	ARHG7_HUMAN Rho guanine nucleotide exchange factor 7 OS=Homo sapiens OX=9606 GN=ARHGEF7 PE=1 SV=2
2	AFDB:O55043	0.445	0.547	2.104E-72	646	0.649	0.807	O55043.pdb.gz	ARHG7_RAT Rho guanine nucleotide exchange factor 7 OS=Rattus norvegicus OX=10116 GN=Arhgef7 PE=1 SV=1
3	PDB:4mt6A	0.232	0.419	6.469E-21	389	0.113	0.234	4mt6A.pdb.gz
4	AFDB:Q7KU89	0.255	0.128	2.253E-18	1904	0.159	0.067	Q7KU89.pdb.gz	Q7KU89_DROME Puratrophin-1-like, isoform A OS=Drosophila melanogaster OX=7227 GN=Pura PE=4 SV=2
5	PDB:7rx9A	0.215	0.388	1.155E-15	432	0.098	0.183	7rx9A.pdb.gz
6	AFDB:P26675	0.210	0.110	7.708E-10	1596	0.105	0.053	P26675.pdb.gz	SOS_DROME Protein son of sevenless OS=Drosophila melanogaster OX=7227 GN=Sos PE=1 SV=2
7	PDB:4gouA	0.180	0.275	1.395E-8	507	0.065	0.103	4gouA.pdb.gz
8	AFDB:O15013	0.243	0.153	1.818E-8	1369	0.092	0.054	O15013.pdb.gz	ARHGA_HUMAN Rho guanine nucleotide exchange factor 10 OS=Homo sapiens OX=9606 GN=ARHGEF10 PE=1 SV=4
9	AFDB:Q8C886	0.128	0.167	6.863E-8	610	0.090	0.118	Q8C886.pdb.gz	PKHN1_MOUSE Probable pleckstrin homology domain-containing family N member 1 OS=Mus musculus OX=10090 GN=Plekhn1 PE=1 SV=2
10	AFDB:Q9XTL2	0.096	0.109	6.475E-7	689	0.125	0.145	Q9XTL2.pdb.gz	Q9XTL2_DROME Jak pathway signal transduction adaptor molecule OS=Drosophila melanogaster OX=7227 GN=Stam PE=1 SV=1
11	AFDB:P25558	0.212	0.114	1.834E-5	1636	0.107	0.053	P25558.pdb.gz	BUD3_YEAST Bud site selection protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BUD3 PE=1 SV=2
12	AFDB:Q80VL0	0.121	0.221	2.104E-5	406	0.056	0.111	Q80VL0.pdb.gz	ICEF1_RAT Interactor protein for cytohesin exchange factors 1 OS=Rattus norvegicus OX=10116 GN=Ipcef1 PE=1 SV=1
13	AFDB:E9PCM6	0.100	0.103	2.203E-5	768	0.059	0.061	E9PCM6.pdb.gz	E9PCM6_HUMAN Rho GTPase activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=1
14	PDB:6u3eA	0.110	0.215	9.205E-5	397	0.059	0.118	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
15	PDB:6bbpA	0.115	0.172	1.670E-4	520	0.051	0.079	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
16	PDB:4mk0A	0.130	0.160	2.099E-4	631	0.032	0.041	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
17	PDB:3ljuX	0.114	0.235	2.640E-4	373	0.029	0.062	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
18	PDB:3ehqA	0.069	0.292	3.171E-4	182	0.029	0.126	3ehqA.pdb.gz
19	PDB:3pvuA	0.127	0.161	4.174E-4	609	0.032	0.043	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
20	PDB:1k9aB	0.066	0.120	7.570E-4	441	0.026	0.048	1k9aB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1QA07	0.0	871	643	0.514	0.642	F1QA07_DANRE Rho guanine nucleotide exchange factor (GEF) 7b OS=Danio rerio OX=7955 GN=arhgef7 PE=1 SV=1
2	O55043	0.0	1065	646	0.649	0.807	ARHG7_RAT Rho guanine nucleotide exchange factor 7 OS=Rattus norvegicus OX=10116 GN=Arhgef7 PE=1 SV=1
3	Q14155	0.0	1664	803	1.000	1.000	ARHG7_HUMAN Rho guanine nucleotide exchange factor 7 OS=Homo sapiens OX=9606 GN=ARHGEF7 PE=1 SV=2
4	Q15052	0.0	837	776	0.523	0.541	ARHG6_HUMAN Rho guanine nucleotide exchange factor 6 OS=Homo sapiens OX=9606 GN=ARHGEF6 PE=1 SV=2
5	Q5PRA8	0.0	1070	799	0.648	0.651	Q5PRA8_DANRE Arhgef7b protein OS=Danio rerio OX=7955 GN=arhgef7 PE=1 SV=1
6	Q8K4I3	0.0	817	771	0.524	0.546	ARHG6_MOUSE Rho guanine nucleotide exchange factor 6 OS=Mus musculus OX=10090 GN=Arhgef6 PE=1 SV=1
7	Q9ES28	0.0	1480	862	0.907	0.845	ARHG7_MOUSE Rho guanine nucleotide exchange factor 7 OS=Mus musculus OX=10090 GN=Arhgef7 PE=1 SV=2
8	C3KGL5	5.48e-116	367	635	0.224	0.283	C3KGL5_DROME GH28580p OS=Drosophila melanogaster OX=7227 GN=RtGEF PE=1 SV=1
9	O62527	1.35e-115	367	687	0.224	0.262	O62527_DROME Rho type GEF OS=Drosophila melanogaster OX=7227 GN=RtGEF PE=2 SV=1
10	Q8SYV1	1.36e-115	367	687	0.224	0.262	Q8SYV1_DROME RE32772p OS=Drosophila melanogaster OX=7227 GN=RtGEF PE=2 SV=1
11	Q9VIN1	1.41e-115	367	687	0.224	0.262	Q9VIN1_DROME Rho-type guanine nucleotide exchange factor, isoform A OS=Drosophila melanogaster OX=7227 GN=RtGEF PE=1 SV=1
12	M9PGB1	7.30e-113	367	923	0.225	0.196	M9PGB1_DROME Rho-type guanine nucleotide exchange factor, isoform G OS=Drosophila melanogaster OX=7227 GN=RtGEF PE=1 SV=1
13	A8DZ20	1.33e-112	367	973	0.224	0.185	A8DZ20_DROME Rho-type guanine nucleotide exchange factor, isoform D OS=Drosophila melanogaster OX=7227 GN=RtGEF PE=1 SV=2
14	M9PBE8	4.21e-111	368	1198	0.224	0.150	M9PBE8_DROME Rho-type guanine nucleotide exchange factor, isoform H OS=Drosophila melanogaster OX=7227 GN=RtGEF PE=1 SV=1
15	A8DZ19	8.40e-111	369	1310	0.224	0.137	A8DZ19_DROME Rho-type guanine nucleotide exchange factor, isoform F OS=Drosophila melanogaster OX=7227 GN=RtGEF PE=1 SV=2
16	E3W735	2.20e-48	179	450	0.148	0.264	E3W735_CAEEL SH3 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=pix-1 PE=1 SV=1
17	Q21430	1.24e-46	179	646	0.148	0.184	Q21430_CAEEL SH3 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=pix-1 PE=1 SV=3
18	Q9NR80	3.27e-32	135	690	0.128	0.149	ARHG4_HUMAN Rho guanine nucleotide exchange factor 4 OS=Homo sapiens OX=9606 GN=ARHGEF4 PE=1 SV=3
19	A0A024RDM6	2.91e-28	123	652	0.130	0.160	A0A024RDM6_HUMAN SPATA13 (Fragment) OS=Homo sapiens OX=9606 GN=SPATA13 PE=4 SV=1
20	Q96N96	2.91e-28	123	652	0.130	0.160	SPT13_HUMAN Spermatogenesis-associated protein 13 OS=Homo sapiens OX=9606 GN=SPATA13 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11971 CAMSAP_CH	32	15.7	CAMSAP CH domain
2	PF00307 CH	8e-07	40.6	Calponin homology (CH) domain
3	PF03272 Mucin_bdg	5e+02	12.0	Putative mucin or carbohydrate-binding module
4	PF00169 PH	1e-05	37.3	PH domain
5	PF00621 RhoGEF	9e-30	115.7	RhoGEF domain
6	PF16615 RhoGEF67_u1	1e-12	59.7	Unstructured region one on RhoGEF 6 and 7
7	PF16614 RhoGEF67_u2	1.6e-44	161.6	Unstructured region two on RhoGEF 6 and 7
8	PF00018 SH3_1	6.7e-13	59.3	SH3 domain
9	PF07653 SH3_2	5.4e-15	66.3	Variant SH3 domain
10	PF14604 SH3_9	5.4e-13	60.0	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364893

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000267257	0.999	Paxillin
2	9606.ENSP00000278568	0.999	Serine/threonine-protein kinase PAK 1
3	9606.ENSP00000314067	0.999	Serine/threonine-protein kinase PAK 2
4	9606.ENSP00000378338	0.999	ARF GTPase-activating protein GIT1
5	9606.ENSP00000383118	0.999	Cell division control protein 42 homolog
6	9606.ENSP00000264033	0.998	E3 ubiquitin-protein ligase CBL
7	9606.ENSP00000347464	0.998	ARF GTPase-activating protein GIT2
8	9606.ENSP00000353864	0.998	Serine/threonine-protein kinase PAK 3
9	9606.ENSP00000349486	0.997	Protein scribble homolog
10	9606.ENSP00000348461	0.993	Ras-related C3 botulinum toxin substrate 1
11	9606.ENSP00000362680	0.985	Proto-oncogene tyrosine-protein kinase Src
12	9606.ENSP00000298910	0.981	Leucine-rich repeat serine/threonine-protein kinase 2
13	9606.ENSP00000250617	0.979	Rho guanine nucleotide exchange factor 6
14	9606.ENSP00000379975	0.972	Integrin-linked protein kinase
15	9606.ENSP00000384273	0.964	Transcription factor p65
16	9606.ENSP00000480499	0.963	E3 ubiquitin-protein ligase Itchy homolog
17	9606.ENSP00000417273	0.959	Cytoplasmic protein NCK1
18	9606.ENSP00000233154	0.953	Cytoplasmic protein NCK2
19	9606.ENSP00000469413	0.947	Serine/threonine-protein kinase PAK 4
20	9606.ENSP00000365745	0.945	Contributes to the organization of the actin cytoskeleton and cell shape . Plays a role in the formation of lamellipodia and in cell migration. Plays a role in the regulation of neuron morphology, axon growth and formation of neuronal growth cones (By similarity). Through its interaction with CTTNBP2, involved in the regulation of neuronal spine density (By similarity). Plays a role in the invasiveness of cancer cells, and the formation of metastases . Plays a role in focal adhesion assembly and turnover (By similarity). In complex with ABL1 and MYLK regulates cortical actin-based cyto [...]

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008092	1.000	cytoskeletal protein binding
GO:0005085	1.000	guanyl-nucleotide exchange factor activity
GO:0019901	0.998	protein kinase binding
GO:0043015	0.989	gamma-tubulin binding
GO:0051020	0.627	GTPase binding
GO:0031267	0.405	small GTPase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0065007	0.991	biological regulation
GO:0050794	0.983	regulation of cellular process
GO:0048522	0.951	positive regulation of cellular process
GO:0050896	0.913	response to stimulus
GO:0071840	0.911	cellular component organization or biogenesis
GO:0016043	0.883	cellular component organization
GO:0051716	0.863	cellular response to stimulus
GO:0023052	0.840	signaling
GO:0007154	0.840	cell communication
GO:0007165	0.828	signal transduction
GO:0051336	0.797	regulation of hydrolase activity
GO:0043085	0.789	positive regulation of catalytic activity
GO:0048856	0.742	anatomical structure development
GO:0051345	0.725	positive regulation of hydrolase activity
GO:0051128	0.713	regulation of cellular component organization
GO:1902903	0.683	regulation of supramolecular fiber organization
GO:0048519	0.675	negative regulation of biological process
GO:0044087	0.663	regulation of cellular component biogenesis
GO:0043087	0.651	regulation of GTPase activity
GO:0032501	0.645	multicellular organismal process
GO:0048523	0.643	negative regulation of cellular process
GO:0043547	0.595	positive regulation of GTPase activity
GO:0022607	0.581	cellular component assembly
GO:0048583	0.540	regulation of response to stimulus
GO:0007166	0.521	cell surface receptor signaling pathway
GO:0051493	0.452	regulation of cytoskeleton organization
GO:0023051	0.445	regulation of signaling
GO:0010646	0.430	regulation of cell communication
GO:0007275	0.363	multicellular organism development
GO:0040012	0.342	regulation of locomotion
GO:0009966	0.327	regulation of signal transduction
GO:0006996	0.324	organelle organization
GO:0065008	0.314	regulation of biological quality

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.997	cytosol
GO:0030054	0.996	cell junction
GO:0043226	0.993	organelle
GO:0043229	0.953	intracellular organelle
GO:0071944	0.952	cell periphery
GO:0005886	0.941	plasma membrane
GO:0120025	0.858	plasma membrane bounded cell projection
GO:0043227	0.824	membrane-bounded organelle
GO:0070161	0.822	anchoring junction
GO:0043231	0.810	intracellular membrane-bounded organelle
GO:0043228	0.692	non-membrane-bounded organelle
GO:0030055	0.684	cell-substrate junction
GO:0043232	0.680	intracellular non-membrane-bounded organelle
GO:0005925	0.658	focal adhesion
GO:0045202	0.629	synapse
GO:0043005	0.551	neuron projection
GO:0032991	0.474	protein-containing complex
GO:0005856	0.450	cytoskeleton
GO:0098794	0.310	postsynapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]