StarFunc result for job id Q14157

User Input

>input (1087 residues)
MMTSVGTNRARGNWEQPQNQNQTQHKQRPQATAEQIRLAQMISDHNDADFEEKVKQLIDI
TGKNQDECVIALHDCNGDVNRAINVLLEGNPDTHSWEMVGKKKGVSGQKDGGQTESNEEG
KENRDRDRDYSRRRGGPPRRGRGASRGREFRGQENGLDGTKSGGPSGRGTERGRRGRGRG
RGGSGRRGGRFSAQGMGTFNPADYAEPANTDDNYGNSSGNTWNNTGHFEPDDGTSAWRTA
TEEWGTEDWNEDLSETKIFTASNVSSVPLPAENVTITAGQRIDLAVLLGKTPSTMENDSS
NLDPSQAPSLAQPLVFSNSKQTAISQPASGNTFSHHSMVSMLGKGFGDVGEAKGGSTTGS
QFLEQFKTAQALAQLAAQHSQSGSTTTSSWDMGSTTQSPSLVQYDLKNPSDSAVHSPFTK
RQAFTPSSTMMEVFLQEKSPAVATSTAAPPPPSSPLPSKSTSAPQMSPGSSDNQSSSPQP
AQQKLKQQKKKASLTSKIPALAVEMPGSADISGLNLQFGALQFGSEPVLSDYESTPTTSA
SSSQAPSSLYTSTASESSSTISSNQSQESGYQSGPIQSTTYTSQNNAQGPLYEQRSTQTR
RYPSSISSSPQKDLTQAKNGFSSVQATQLQTTQSVEGATGSAVKSDSPSTSSIPPLNETV
SAASLLTTTNQHSSSLGGLSHSEEIPNTTTTQHSSTLSTQQNTLSSSTSSGRTSTSTLLH
TSVESEANLHSSSSTFSTTSSTVSAPPPVVSVSSSLNSGSSLGLSLGSNSTVTASTRSSV
ATTSGKAPPNLPPGVPPLLPNPYIMAPGLLHAYPPQVYGYDDLQMLQTRFPLDYYSIPFP
TPTTPLTGRDGSLASNPYSGDLTKFGRGDASSPAPATTLAQPQQNQTQTHHTTQQTFLNP
ALPPGYSYTSLPYYTGVPGLPSTFQYGPAVFPVAPTSSKQHGVNVSVNASATPFQQPSGY
GSHGYNTGVSVTSSNTGVPDISGSVYSKTQQSFEKQGFHSGTPAASFNLPSALGSGGPIN
PATAAAYPPAPFMHILTPHQQPHSQILHHHLQQDGQTGSGQRSQTSSIPQKPQTNKSAYN
SYSWGAN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14157	0.999	0.999	0.000	1087	1.000	1.000	Q14157.pdb.gz	UBP2L_HUMAN Ubiquitin-associated protein 2-like OS=Homo sapiens OX=9606 GN=UBAP2L PE=1 SV=2
2	AFDB:Q80X50	0.163	0.161	0.000	1107	0.981	0.963	Q80X50.pdb.gz	UBP2L_MOUSE Ubiquitin-associated protein 2-like OS=Mus musculus OX=10090 GN=Ubap2l PE=1 SV=1
3	AFDB:Q5T6F2	0.181	0.177	3.703E-50	1119	0.486	0.472	Q5T6F2.pdb.gz	UBAP2_HUMAN Ubiquitin-associated protein 2 OS=Homo sapiens OX=9606 GN=UBAP2 PE=1 SV=1
4	AFDB:Q86S05	0.067	0.056	8.561E-11	1375	0.274	0.217	Q86S05.pdb.gz	LIG_DROME Protein lingerer OS=Drosophila melanogaster OX=7227 GN=lig PE=1 SV=1
5	AFDB:O43024	0.068	0.075	2.974E-3	963	0.149	0.168	O43024.pdb.gz	DEF1_SCHPO RNA polymerase II degradation factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=def1 PE=1 SV=1
6	AFDB:Q0WUY5	0.054	0.067	3.173E-3	841	0.161	0.208	Q0WUY5.pdb.gz	Q0WUY5_ARATH Flocculation protein (DUF1296) OS=Arabidopsis thaliana OX=3702 GN=At3g07660 PE=1 SV=1
7	AFDB:Q8L7T4	0.066	0.079	4.386E-3	848	0.133	0.171	Q8L7T4.pdb.gz	Q8L7T4_ARATH AT3g13990/MDC16_11 OS=Arabidopsis thaliana OX=3702 GN=At3g13990 PE=1 SV=1
8	AFDB:Q9NZ56	0.041	0.031	2.871E-2	1722	0.162	0.102	Q9NZ56.pdb.gz	FMN2_HUMAN Formin-2 OS=Homo sapiens OX=9606 GN=FMN2 PE=1 SV=4
9	AFDB:Q5B9A9	0.057	0.067	4.519E-2	870	0.157	0.197	Q5B9A9.pdb.gz	Q5B9A9_EMENI RNA polymerase II degradation factor 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02871 PE=3 SV=1
10	AFDB:Q5RHP9	0.046	0.035	6.666E-2	1530	0.134	0.095	Q5RHP9.pdb.gz	ERIC3_HUMAN Glutamate-rich protein 3 OS=Homo sapiens OX=9606 GN=ERICH3 PE=1 SV=1
11	PDB:3e46A	0.039	0.205	1.108E-1	202	0.009	0.050	3e46A.pdb.gz
12	PDB:4f1iA	0.041	0.130	1.634E-1	328	0.009	0.030	4f1iA.pdb.gz
13	PDB:3bq3A	0.037	0.161	4.917E-1	250	0.006	0.024	3bq3A.pdb.gz
14	PDB:3ihpB	0.034	0.054	5.597E-1	681	0.008	0.013	3ihpB.pdb.gz	Covalent Ubiquitin-Usp5 Complex
15	PDB:6c95D	0.042	0.389	7.738E-1	95	0.008	0.095	6c95D.pdb.gz	Structure of Human NatA and Its Regulation by the Huntingtin Interacting Protein HYPK.
16	PDB:7b5lH	0.037	0.092	8.256E-1	423	0.006	0.017	7b5lH.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
17	PDB:4xb6C	0.038	0.109	1.070	353	0.012	0.037	4xb6C.pdb.gz	Structural insights into the bacterial carbon-phosphorus lyase machinery.
18	PDB:3wg6A	0.035	0.107	1.386	299	0.006	0.020	3wg6A.pdb.gz	Crystal structure of conjugated polyketone reductase (CPR-C1) from Candida parapsilosis IFO 0708 complexed with NADPH.
19	PDB:5gm6K	0.031	0.252	1.386	84	0.007	0.095	5gm6K.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
20	PDB:1oqyA	0.040	0.113	1.578	363	0.017	0.052	1oqyA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14157	0.0	2191	1087	1.000	1.000	UBP2L_HUMAN Ubiquitin-associated protein 2-like OS=Homo sapiens OX=9606 GN=UBAP2L PE=1 SV=2
2	Q5T6F2	0.0	685	1119	0.499	0.484	UBAP2_HUMAN Ubiquitin-associated protein 2 OS=Homo sapiens OX=9606 GN=UBAP2 PE=1 SV=1
3	Q80X50	0.0	2138	1107	0.982	0.964	UBP2L_MOUSE Ubiquitin-associated protein 2-like OS=Mus musculus OX=10090 GN=Ubap2l PE=1 SV=1
4	Q86S05	8.16e-12	72.4	1375	0.052	0.041	LIG_DROME Protein lingerer OS=Drosophila melanogaster OX=7227 GN=lig PE=1 SV=1
5	O61708	0.003	43.9	712	0.020	0.031	O61708_CAEEL Protein lingerer OS=Caenorhabditis elegans OX=6239 GN=pqn-59 PE=1 SV=2
6	A0A0R4IBK5	1.8	35.4	5209	0.052	0.011	R213A_DANRE E3 ubiquitin-protein ligase rnf213-alpha OS=Danio rerio OX=7955 GN=rnf213a PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15957 Comm	87	14.9	Commissureless
2	PF02845 CUE	5.9e+02	11.6	CUE domain
3	PF12478 DUF3697	8.5e-12	56.3	Ubiquitin-associated protein 2
4	PF06972 GIP1_N	73	14.9	GBF-interacting protein 1 N-terminal
5	PF14555 UBA_4	2.9	19.1	UBA-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000389445

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000365851	0.926	Polycomb complex protein BMI-1
2	9606.ENSP00000420294	0.926	Polyhomeotic-like protein 3
3	9606.ENSP00000250113	0.921	Fragile X mental retardation syndrome-related protein 2
4	9606.ENSP00000369424	0.919	Histone-binding protein RBBP7
5	9606.ENSP00000257118	0.913	Polyhomeotic-like protein 2
6	9606.ENSP00000316578	0.908	Polycomb protein SUZ12
7	9606.ENSP00000362592	0.907	Histone-binding protein RBBP4
8	9606.ENSP00000377681	0.905	Ras GTPase-activating protein-binding protein 1
9	9606.ENSP00000440674	0.905	Polyhomeotic-like protein 1
10	9606.ENSP00000263360	0.903	Polycomb protein EED
11	9606.ENSP00000363787	0.903	E3 ubiquitin-protein ligase RING1
12	9606.ENSP00000430432	0.903	Histone deacetylase 2
13	9606.ENSP00000358862	0.902	Polycomb group RING finger protein 6
14	9606.ENSP00000216133	0.900	Chromobox protein homolog 7
15	9606.ENSP00000233630	0.900	Polycomb group RING finger protein 1
16	9606.ENSP00000251900	0.900	Sex comb on midleg-like protein 2
17	9606.ENSP00000269385	0.900	Chromobox protein homolog 8
18	9606.ENSP00000269397	0.900	E3 SUMO-protein ligase CBX4
19	9606.ENSP00000308750	0.900	Chromobox protein homolog 2
20	9606.ENSP00000320147	0.900	Histone-lysine N-methyltransferase EZH2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.947	cellular process
GO:0071840	0.817	cellular component organization or biogenesis
GO:0016043	0.771	cellular component organization
GO:0032501	0.762	multicellular organismal process
GO:0065007	0.665	biological regulation
GO:0050789	0.664	regulation of biological process
GO:0050794	0.574	regulation of cellular process
GO:0061484	0.555	hematopoietic stem cell homeostasis
GO:0071704	0.356	organic substance metabolic process
GO:0019222	0.350	regulation of metabolic process
GO:0060255	0.340	regulation of macromolecule metabolic process
GO:0044085	0.307	cellular component biogenesis
GO:0010468	0.301	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031519	0.999	PcG protein complex
GO:0070013	0.959	intracellular organelle lumen
GO:0005737	0.949	cytoplasm
GO:0005654	0.937	nucleoplasm
GO:0005829	0.913	cytosol
GO:0043232	0.888	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]