StarFunc result for job id Q14159

User Input

>input (915 residues)
MPRGSRARGSKRKRSWNTECPSFPGERPLQVRRAGLRTAGAAASLSEAWLRCGEGFQNTS
GNPSLTAEEKTITEKHLELCPRPKQETTTSKSTSGLTDITWSSSGSDLSDEDKTLSQLQR
DELQFIDWEIDSDRAEASDCDEFEDDEGAVEISDCASCASNQSLTSDEKLSELPKPSSIE
ILEYSSDSEKEDDLENVLLIDSESPHKYHVQFASDARQIMERLIDPRTKSTETILHTPQK
PTAKFPRTPENSAKKKLLRGGLAERLNGLQNRERSAISLWRHQCISYQKTLSGRKSGVLT
VKILELHEECAMQVAMCEQLLGSPATSSSQSVAPRPGAGLKVLFTKETAGYLRGRPQDTV
RIFPPWQKLIIPSGSCPVILNTYFCEKVVAKEDSEKTCEVYCPDIPLPRRSISLAQMFVI
KGLTNNSPEIQVVCSGVATTGTAWTHGHKEAKQRIPTSTPLRDSLLDVVESQGAASWPGA
GVRVVVQRVYSLPSRDSTRGQQGASSGHTDPAGTRACLLVQDACGMFGEVHLEFTMSKAR
QLEGKSCSLVGMKVLQKVTRGRTAGIFSLIDTLWPPAIPLKTPGRDQPCEEIKTHLPPPA
LCYILTAHPNLGQIDIIDEDPIYKLYQPPVTRCLRDILQMNDLGTRCSFYATVIYQKPQL
KSLLLLEQREIWLLVTDVTLQTKEERDPRLPKTLLVYVAPLCVLGSEVLEALAGAAPHSL
FFKDALRDQGRIVCAERTVLLLQKPLLSVVSGASSCELPGPVMLDSLDSATPVNSICSVQ
GTVVGVDESTAFSWPVCDMCGNGRLEQRPEDRGAFSCGDCSRVVTSPVLKRHLQVFLDCR
SRPQCRVKVKLLQRSISSLLRFAAGEDGSYEVKSVLGKEVGLLNCFVQSVTAHPTSCIGL
EEIELLSAGGASAEH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14159	1.000	1.000	0.000	915	1.000	1.000	Q14159.pdb.gz	SPIDR_HUMAN DNA repair-scaffolding protein OS=Homo sapiens OX=9606 GN=SPIDR PE=1 SV=2
2	PDB:6w6wA	0.211	0.213	1.669E-9	905	0.083	0.084	6w6wA.pdb.gz	The structure of human CST reveals a decameric assembly bound to telomeric DNA.
3	PDB:8d0bA	0.205	0.178	3.440E-9	1116	0.082	0.067	8d0bA.pdb.gz	Structures of the human CST-Pol alpha-primase complex bound to telomere templates.
4	PDB:7u5cE	0.198	0.168	7.158E-7	1147	0.093	0.074	7u5cE.pdb.gz	Cryo-EM structure of the human CST-Pol alpha /primase complex in a recruitment state.
5	PDB:2i0qA	0.108	0.192	8.458E-7	461	0.054	0.106	2i0qA.pdb.gz	Structural reorganization and the cooperative binding of single-stranded telomere DNA in Sterkiella nova.
6	PDB:7uy5I	0.152	0.232	9.993E-7	528	0.052	0.091	7uy5I.pdb.gz	Structure of Tetrahymena telomerase-bound CST with polymerase alpha-primase.
7	PDB:7uy7A	0.152	0.230	1.801E-5	552	0.055	0.091	7uy7A.pdb.gz	Structure of Tetrahymena telomerase-bound CST with polymerase alpha-primase.
8	PDB:7qxbP	0.140	0.400	2.457E-4	251	0.026	0.096	7qxbP.pdb.gz	Structural basis of human telomerase recruitment by TPP1-POT1.
9	AFDB:B2RTX2	0.050	0.044	1.628E-3	1106	0.125	0.103	B2RTX2.pdb.gz	B2RTX2_HUMAN Palladin, cytoskeletal associated protein OS=Homo sapiens OX=9606 GN=PALLD PE=2 SV=1
10	AFDB:Q14160	0.068	0.053	1.819E-3	1630	0.131	0.074	Q14160.pdb.gz	SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens OX=9606 GN=SCRIB PE=1 SV=5
11	AFDB:Q54NE5	0.049	0.032	2.402E-3	1918	0.105	0.050	Q54NE5.pdb.gz	Q54NE5_DICDI Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0285313 PE=4 SV=1
12	AFDB:Q3U8K7	0.057	0.059	2.101E-2	883	0.073	0.076	Q3U8K7.pdb.gz	KMT5B_MOUSE Histone-lysine N-methyltransferase KMT5B OS=Mus musculus OX=10090 GN=Kmt5b PE=1 SV=2
13	PDB:6aggZ	0.090	0.161	2.933E-2	420	0.023	0.050	6aggZ.pdb.gz	Structure of tRNA-Modifying Enzyme TiaS and Motions of Its Substrate Binding Zinc Ribbon.
14	PDB:7plo5	0.070	0.101	4.094E-2	614	0.021	0.031	7plo5.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
15	PDB:5zg8A	0.089	0.178	4.576E-2	422	0.016	0.036	5zg8A.pdb.gz
16	AFDB:Q17865	0.050	0.073	7.140E-2	545	0.081	0.136	Q17865.pdb.gz	YTE4_CAEEL Uncharacterized protein C09G1.4 OS=Caenorhabditis elegans OX=6239 GN=C09G1.4 PE=1 SV=3
17	AFDB:E9Q4Y4	0.062	0.032	7.548E-2	2514	0.136	0.049	E9Q4Y4.pdb.gz	E9Q4Y4_MOUSE Centrosomal protein 192 OS=Mus musculus OX=10090 GN=Cep192 PE=1 SV=1
18	AFDB:P21513	0.035	0.032	9.428E-2	1061	0.071	0.061	P21513.pdb.gz	RNE_ECOLI Ribonuclease E OS=Escherichia coli (strain K12) OX=83333 GN=rne PE=1 SV=6
19	AFDB:Q61191	0.053	0.030	1.054E-1	2045	0.116	0.052	Q61191.pdb.gz	HCFC1_MOUSE Host cell factor 1 OS=Mus musculus OX=10090 GN=Hcfc1 PE=1 SV=2
20	AFDB:Q4FZB7	0.046	0.048	1.178E-1	885	0.068	0.070	Q4FZB7.pdb.gz	KMT5B_HUMAN Histone-lysine N-methyltransferase KMT5B OS=Homo sapiens OX=9606 GN=KMT5B PE=1 SV=5

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B3KP42	0.0	798	390	0.426	1.000	B3KP42_HUMAN Scaffold protein involved in DNA repair OS=Homo sapiens OX=9606 GN=SPIDR PE=1 SV=1
2	H0YBC9	0.0	1012	497	0.539	0.992	H0YBC9_HUMAN Scaffold protein involved in DNA repair (Fragment) OS=Homo sapiens OX=9606 GN=SPIDR PE=1 SV=1
3	Q14159	0.0	1869	915	1.000	1.000	SPIDR_HUMAN DNA repair-scaffolding protein OS=Homo sapiens OX=9606 GN=SPIDR PE=1 SV=2
4	Q8IZQ1	2.8	34.3	3526	0.037	0.010	WDFY3_HUMAN WD repeat and FYVE domain-containing protein 3 OS=Homo sapiens OX=9606 GN=WDFY3 PE=1 SV=2
5	Q6VNB8	3.6	33.9	3508	0.037	0.010	WDFY3_MOUSE WD repeat and FYVE domain-containing protein 3 OS=Mus musculus OX=10090 GN=Wdfy3 PE=1 SV=1
6	O17470	6.1	33.1	683	0.050	0.067	O17470_CAEEL G-protein coupled receptors family 1 profile domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ser-1 PE=2 SV=1
7	G5ECV2	6.9	32.7	635	0.050	0.072	G5ECV2_CAEEL G-protein coupled receptors family 1 profile domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ser-1 PE=2 SV=1
8	O94423	9.0	32.3	421	0.019	0.040	MFR1_SCHPO Meiotic fizzy-related protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mfr1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14950 DUF4502	1.5e-177	602.5	Domain of unknown function (DUF4502)
2	PF14951 DUF4503	9.5e-192	648.4	Domain of unknown function (DUF4503)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000297423

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000372088	0.942	DNA repair protein RAD51 homolog 1
2	9606.ENSP00000369497	0.934	Breast cancer type 2 susceptibility protein
3	9606.ENSP00000265433	0.923	Nibrin
4	9606.ENSP00000418960	0.921	Breast cancer type 1 susceptibility protein
5	9606.ENSP00000451974	0.913	DNA repair protein XRCC3
6	9606.ENSP00000298139	0.909	Werner syndrome ATP-dependent helicase
7	9606.ENSP00000336701	0.907	DNA repair protein RAD51 homolog 3
8	9606.ENSP00000352271	0.906	DNA repair protein XRCC2
9	9606.ENSP00000419471	0.906	DNA repair protein RAD51 homolog 2
10	9606.ENSP00000261584	0.905	Partner and localizer of BRCA2
11	9606.ENSP00000260947	0.903	BRCA1-associated RING domain protein 1
12	9606.ENSP00000278616	0.903	Serine-protein kinase ATM
13	9606.ENSP00000410811	0.901	Fidgetin-like protein 1
14	9606.ENSP00000228843	0.900	RAD51-associated protein 1
15	9606.ENSP00000259008	0.900	Fanconi anemia group J protein
16	9606.ENSP00000325863	0.900	Double-strand break repair protein MRE11
17	9606.ENSP00000340330	0.900	Histone acetyltransferase KAT5
18	9606.ENSP00000351185	0.900	DNA replication ATP-dependent helicase/nuclease DNA2
19	9606.ENSP00000355506	0.900	Exonuclease 1
20	9606.ENSP00000368100	0.900	DNA repair protein RAD50

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003677	0.468	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.987	organic substance metabolic process
GO:0050896	0.985	response to stimulus
GO:0044238	0.985	primary metabolic process
GO:0044237	0.985	cellular metabolic process
GO:0050794	0.984	regulation of cellular process
GO:0006310	0.975	DNA recombination
GO:0000724	0.972	double-strand break repair via homologous recombination
GO:0010212	0.961	response to ionizing radiation
GO:0051054	0.950	positive regulation of DNA metabolic process
GO:0000018	0.902	regulation of DNA recombination
GO:0006282	0.900	regulation of DNA repair
GO:0048584	0.854	positive regulation of response to stimulus
GO:2001022	0.832	positive regulation of response to DNA damage stimulus
GO:0104004	0.821	cellular response to environmental stimulus
GO:0071478	0.801	cellular response to radiation
GO:0071479	0.788	cellular response to ionizing radiation
GO:2000779	0.756	regulation of double-strand break repair
GO:0051128	0.741	regulation of cellular component organization
GO:0045739	0.696	positive regulation of DNA repair
GO:0051130	0.459	positive regulation of cellular component organization
GO:0071840	0.451	cellular component organization or biogenesis
GO:0016043	0.419	cellular component organization
GO:0010569	0.407	regulation of double-strand break repair via homologous recombination
GO:0006996	0.401	organelle organization
GO:2000781	0.396	positive regulation of double-strand break repair
GO:0042221	0.369	response to chemical
GO:0048523	0.338	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005694	0.999	chromosome
GO:0032991	0.947	protein-containing complex
GO:0000228	0.947	nuclear chromosome
GO:0005737	0.509	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]