StarFunc result for job id Q14160

User Input

>input (1630 residues)
MLKCIPLWRCNRHVESVDKRHCSLQAVPEEIYRYSRSLEELLLDANQLRELPKPFFRLLN
LRKLGLSDNEIQRLPPEVANFMQLVELDVSRNDIPEIPESIKFCKALEIADFSGNPLSRL
PDGFTQLRSLAHLALNDVSLQALPGDVGNLANLVTLELRENLLKSLPASLSFLVKLEQLD
LGGNDLEVLPDTLGALPNLRELWLDRNQLSALPPELGNLRRLVCLDVSENRLEELPAELG
GLVLLTDLLLSQNLLRRLPDGIGQLKQLSILKVDQNRLCEVTEAIGDCENLSELILTENL
LMALPRSLGKLTKLTNLNVDRNHLEALPPEIGGCVALSVLSLRDNRLAVLPPELAHTTEL
HVLDVAGNRLQSLPFALTHLNLKALWLAENQAQPMLRFQTEDDARTGEKVLTCYLLPQQP
PPSLEDAGQQGSLSETWSDAPPSRVSVIQFLEAPIGDEDAEEAAAEKRGLQRRATPHPSE
LKVMKRSIEGRRSEACPCQPDSGSPLPAEEEKRLSAESGLSEDSRPSASTVSEAEPEGPS
AEAQGGSQQEATTAGGEEDAEEDYQEPTVHFAEDALLPGDDREIEEGQPEAPWTLPGGRQ
RLIRKDTPHYKKHFKISKLPQPEAVVALLQGMQPDGEGPVAPGGWHNGPHAPWAPRAQKE
EEEEEEGSPQEEEVEEEEENRAEEEEASTEEEDKEGAVVSAPSVKGVSFDQANNLLIEPA
RIEEEELTLTILRQTGGLGISIAGGKGSTPYKGDDEGIFISRVSEEGPAARAGVRVGDKL
LEVNGVALQGAEHHEAVEALRGAGTAVQMRVWRERMVEPENAVTITPLRPEDDYSPRERR
GGGLRLPLLPPESPGPLRQRHVACLARSERGLGFSIAGGKGSTPYRAGDAGIFVSRIAEG
GAAHRAGTLQVGDRVLSINGVDVTEARHDHAVSLLTAASPTIALLLEREAGGPLPPSPLP
HSSPPTAAVATTSITTATPGVPGLPSLAPSLLAAALEGPYPVEEIRLPRAGGPLGLSIVG
GSDHSSHPFGVQEPGVFISKVLPRGLAARSGLRVGDRILAVNGQDVRDATHQEAVSALLR
PCLELSLLVRRDPAPPGLRELCIQKAPGERLGISIRGGARGHAGNPRDPTDEGIFISKVS
PTGAAGRDGRLRVGLRLLEVNQQSLLGLTHGEAVQLLRSVGDTLTVLVCDGFEASTDAAL
EVSPGVIANPFAAGIGHRNSLESISSIDRELSPEGPGKEKELPGQTLHWGPEATEAAGRG
LQPLKLDYRALAAVPSAGSVQRVPSGAAGGKMAESPCSPSGQQPPSPPSPDELPANVKQA
YRAFAAVPTSHPPEDAPAQPPTPGPAASPEQLSFRERQKYFELEVRVPQAEGPPKRVSLV
GADDLRKMQEEEARKLQQKRAQMLREAAEAGAEARLALDGETLGEEEQEDEQPPWASPSP
TSRQSPASPPPLGGGAPVRTAKAERRHQERLRVQSPEPPAPERALSPAELRALEAEKRAL
WRAARMKSLEQDALRAQMVLSRSQEGRGTRGPLERLAEAPSPAPTPSPTPVEDLGPQTST
SPGRLSPDFAEELRSLEPSPSPGPQEEDGEVALVLLGRPSPGAVGPEDVALCSSRRPVRP
GRRGLGPVPS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZWS0	0.432	0.424	0.000	1663	0.869	0.852	D3ZWS0.pdb.gz	D3ZWS0_RAT Scribble planar cell polarity protein OS=Rattus norvegicus OX=10116 GN=Scrib PE=1 SV=2
2	AFDB:Q14160	0.999	0.999	0.000	1630	1.000	1.000	Q14160.pdb.gz	SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens OX=9606 GN=SCRIB PE=1 SV=5
3	AFDB:Q4H4B6	0.452	0.434	0.000	1724	0.625	0.591	Q4H4B6.pdb.gz	SCRIB_DANRE Protein scribble homolog OS=Danio rerio OX=7955 GN=scrib PE=1 SV=1
4	AFDB:Q7KRY7	0.288	0.256	0.000	1851	0.389	0.343	Q7KRY7.pdb.gz	SCRIB_DROME Protein lap4 OS=Drosophila melanogaster OX=7227 GN=scrib PE=1 SV=1
5	AFDB:Q80U72	0.430	0.434	0.000	1612	0.866	0.876	Q80U72.pdb.gz	SCRIB_MOUSE Protein scribble homolog OS=Mus musculus OX=10090 GN=Scrib PE=1 SV=2
6	AFDB:Q9BTT6	0.261	0.801	9.867E-61	524	0.196	0.611	Q9BTT6.pdb.gz	LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=LRRC1 PE=1 SV=1
7	AFDB:Q80TH2	0.268	0.310	1.494E-50	1402	0.210	0.245	Q80TH2.pdb.gz	ERBIN_MOUSE Erbin OS=Mus musculus OX=10090 GN=Erbin PE=1 SV=3
8	AFDB:P70587	0.253	0.277	3.745E-50	1490	0.227	0.248	P70587.pdb.gz	LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus OX=10116 GN=Lrrc7 PE=1 SV=2
9	AFDB:Q96NW7	0.257	0.272	4.365E-50	1537	0.231	0.245	Q96NW7.pdb.gz	LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens OX=9606 GN=LRRC7 PE=1 SV=1
10	AFDB:Q96RT1	0.258	0.297	6.568E-50	1412	0.197	0.227	Q96RT1.pdb.gz	ERBIN_HUMAN Erbin OS=Homo sapiens OX=9606 GN=ERBIN PE=1 SV=2
11	PDB:7tvfD	0.159	0.381	5.484E-23	515	0.072	0.229	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
12	PDB:2xkxA	0.057	0.125	7.383E-21	721	0.082	0.186	2xkxA.pdb.gz
13	PDB:7p5vB	0.168	0.339	2.191E-12	732	0.064	0.143	7p5vB.pdb.gz
14	PDB:6m04A	0.180	0.371	3.634E-11	714	0.054	0.123	6m04A.pdb.gz
15	PDB:6hkwA	0.159	0.786	7.058E-11	306	0.046	0.245	6hkwA.pdb.gz
16	PDB:6gffI	0.200	0.553	1.682E-10	551	0.074	0.220	6gffI.pdb.gz
17	PDB:5xjxC	0.151	0.603	2.802E-10	365	0.049	0.219	5xjxC.pdb.gz
18	PDB:7lt9A	0.095	0.458	4.007E-10	251	0.047	0.303	7lt9A.pdb.gz	Molecular basis for Ras suppressor-1 binding to PINCH-1 in focal adhesion assembly.
19	PDB:7wv3A	0.125	0.211	7.027E-10	668	0.071	0.172	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
20	PDB:5yq5B	0.134	0.611	4.418E-9	306	0.042	0.225	5yq5B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A669KB89	0.0	3185	1658	0.999	0.983	A0A669KB89_HUMAN Scribble planar cell polarity protein OS=Homo sapiens OX=9606 GN=SCRIB PE=1 SV=1
2	A0A8I6ABB5	0.0	2536	1589	0.861	0.883	A0A8I6ABB5_RAT Scribble planar cell polarity protein OS=Rattus norvegicus OX=10116 GN=Scrib PE=1 SV=1
3	A0A8I6ANK4	0.0	2513	1589	0.855	0.877	A0A8I6ANK4_RAT Scribble planar cell polarity protein OS=Rattus norvegicus OX=10116 GN=Scrib PE=1 SV=1
4	A0A8I6APB3	0.0	2568	1610	0.867	0.878	A0A8I6APB3_RAT Scribble planar cell polarity protein OS=Rattus norvegicus OX=10116 GN=Scrib PE=1 SV=1
5	D3ZWS0	0.0	2559	1638	0.869	0.864	D3ZWS0_RAT Scribble planar cell polarity protein OS=Rattus norvegicus OX=10116 GN=Scrib PE=1 SV=2
6	H0YCG0	0.0	1197	650	0.383	0.962	H0YCG0_HUMAN SCRIB overlapping open reading frame protein (Fragment) OS=Homo sapiens OX=9606 GN=SCRIB PE=1 SV=1
7	Q14160	0.0	3204	1630	0.999	0.999	SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens OX=9606 GN=SCRIB PE=1 SV=5
8	Q4H4B6	0.0	1793	1724	0.635	0.600	SCRIB_DANRE Protein scribble homolog OS=Danio rerio OX=7955 GN=scrib PE=1 SV=1
9	Q80U72	0.0	2556	1612	0.868	0.878	SCRIB_MOUSE Protein scribble homolog OS=Mus musculus OX=10090 GN=Scrib PE=1 SV=2
10	Q9BTT6	0.0	642	524	0.198	0.615	LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=LRRC1 PE=1 SV=1
11	Q7KRY7	1.01e-177	584	1851	0.183	0.161	SCRIB_DROME Protein lap4 OS=Drosophila melanogaster OX=7227 GN=scrib PE=1 SV=1
12	Q80TH2	7.69e-114	396	1402	0.140	0.163	ERBIN_MOUSE Erbin OS=Mus musculus OX=10090 GN=Erbin PE=1 SV=3
13	Q96RT1	9.34e-114	396	1412	0.142	0.164	ERBIN_HUMAN Erbin OS=Homo sapiens OX=9606 GN=ERBIN PE=1 SV=2
14	A0A075B6E9	2.78e-113	396	1495	0.129	0.141	A0A075B6E9_HUMAN Leucine rich repeat containing 7 OS=Homo sapiens OX=9606 GN=LRRC7 PE=1 SV=1
15	P70587	3.21e-113	395	1490	0.130	0.142	LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus OX=10116 GN=Lrrc7 PE=1 SV=2
16	Q96NW7	3.81e-113	396	1537	0.129	0.137	LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens OX=9606 GN=LRRC7 PE=1 SV=1
17	A0A494C1A4	4.51e-113	396	1575	0.129	0.134	A0A494C1A4_HUMAN Leucine rich repeat containing 7 OS=Homo sapiens OX=9606 GN=LRRC7 PE=1 SV=1
18	A0A8I5ZN42	7.47e-113	390	1230	0.139	0.185	A0A8I5ZN42_RAT Erbb2 interacting protein OS=Rattus norvegicus OX=10116 GN=Erbin PE=1 SV=1
19	A0A8I6A8N1	1.57e-112	390	1295	0.139	0.175	A0A8I6A8N1_RAT Erbb2 interacting protein OS=Rattus norvegicus OX=10116 GN=Erbin PE=1 SV=1
20	A0A8I6ACI5	4.07e-112	390	1364	0.139	0.166	A0A8I6ACI5_RAT Erbb2 interacting protein OS=Rattus norvegicus OX=10116 GN=Erbin PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12799 LRR_4	4.8e-20	82.5	Leucine Rich repeats (2 copies)
2	PF13855 LRR_8	2.4e-28	109.0	Leucine rich repeat
3	PF14580 LRR_9	0.011	26.8	Leucine-rich repeat
4	PF00595 PDZ	1.8e-74	257.4	PDZ domain
5	PF13180 PDZ_2	1.6e-18	78.1	PDZ domain
6	PF17816 PDZ_4	5	18.8	PDZ domain
7	PF17820 PDZ_6	4.5e-37	137.0	PDZ domain
8	PF02163 Peptidase_M50	1.5e-11	55.8	Peptidase family M50
9	PF14685 Tricorn_PDZ	0.046	25.0	Tricorn protease PDZ domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000349486

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000364893	0.997	Rho guanine nucleotide exchange factor 7
2	9606.ENSP00000357040	0.985	Vang-like protein 2
3	9606.ENSP00000376333	0.975	Lethal(2) giant larvae protein homolog 2
4	9606.ENSP00000321537	0.959	Lethal(2) giant larvae protein homolog 1
5	9606.ENSP00000232165	0.917	Ubiquitin-protein ligase E3A
6	9606.ENSP00000345731	0.913	Disks large homolog 1
7	9606.ENSP00000383118	0.905	Cell division control protein 42 homolog
8	9606.ENSP00000365272	0.897	Disks large homolog 2
9	9606.ENSP00000363480	0.896	Disks large homolog 3
10	9606.ENSP00000382428	0.892	Disks large homolog 4
11	9606.ENSP00000262719	0.881	PH domain leucine-rich repeat-containing protein phosphatase 1
12	9606.ENSP00000347672	0.877	VANGL planar cell polarity protein 1
13	9606.ENSP00000341779	0.871	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
14	9606.ENSP00000344456	0.860	Catenin beta-1
15	9606.ENSP00000361467	0.856	Disks large homolog 5
16	9606.ENSP00000437550	0.851	Serine/threonine-protein kinase LATS1
17	9606.ENSP00000437489	0.825	Frizzled-3
18	9606.ENSP00000289104	0.822	Ras-related protein M-Ras
19	9606.ENSP00000263635	0.804	Protein TANC1
20	9606.ENSP00000378338	0.785	ARF GTPase-activating protein GIT1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0050839	0.581	cell adhesion molecule binding
GO:0045296	0.569	cadherin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0065007	0.987	biological regulation
GO:0050794	0.984	regulation of cellular process
GO:0032502	0.960	developmental process
GO:0032501	0.952	multicellular organismal process
GO:0048856	0.945	anatomical structure development
GO:0072659	0.938	protein localization to plasma membrane
GO:0007275	0.909	multicellular organism development
GO:0032879	0.886	regulation of localization
GO:0042063	0.879	gliogenesis
GO:0051049	0.865	regulation of transport
GO:0045184	0.854	establishment of protein localization
GO:0006810	0.851	transport
GO:0065008	0.846	regulation of biological quality
GO:0016197	0.839	endosomal transport
GO:0031503	0.835	protein-containing complex localization
GO:0051128	0.821	regulation of cellular component organization
GO:0062237	0.813	protein localization to postsynapse
GO:0098876	0.810	vesicle-mediated transport to the plasma membrane
GO:0060627	0.740	regulation of vesicle-mediated transport
GO:0050896	0.694	response to stimulus
GO:0099003	0.659	vesicle-mediated transport in synapse
GO:0090150	0.659	establishment of protein localization to membrane
GO:0097120	0.643	receptor localization to synapse
GO:0030100	0.640	regulation of endocytosis
GO:0032456	0.630	endocytic recycling
GO:0061951	0.628	establishment of protein localization to plasma membrane
GO:0048518	0.592	positive regulation of biological process
GO:0016477	0.487	cell migration
GO:0099072	0.481	regulation of postsynaptic membrane neurotransmitter receptor levels
GO:0048522	0.473	positive regulation of cellular process
GO:1903539	0.463	protein localization to postsynaptic membrane
GO:0048259	0.447	regulation of receptor-mediated endocytosis
GO:0071705	0.430	nitrogen compound transport
GO:0048523	0.425	negative regulation of cellular process
GO:0008347	0.398	glial cell migration
GO:0002090	0.394	regulation of receptor internalization
GO:0071702	0.323	organic substance transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.995	organelle
GO:0030054	0.995	cell junction
GO:0005737	0.995	cytoplasm
GO:0005886	0.995	plasma membrane
GO:0031981	0.985	nuclear lumen
GO:0070161	0.984	anchoring junction
GO:0005654	0.984	nucleoplasm
GO:0045202	0.976	synapse
GO:0098590	0.968	plasma membrane region
GO:0045211	0.953	postsynaptic membrane
GO:0005911	0.938	cell-cell junction
GO:0005829	0.899	cytosol
GO:0099634	0.856	postsynaptic specialization membrane
GO:0098839	0.830	postsynaptic density membrane
GO:0099243	0.828	extrinsic component of synaptic membrane
GO:0098890	0.802	extrinsic component of postsynaptic membrane
GO:0098978	0.743	glutamatergic synapse
GO:0098892	0.567	extrinsic component of postsynaptic specialization membrane
GO:0070062	0.423	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]