StarFunc result for job id Q14161

User Input

>input (759 residues)
MSKRLRSSEVCADCSGPDPSWASVNRGTFLCDECCSVHRSLGRHISQVRHLKHTPWPPTL
LQMVETLYNNGANSIWEHSLLDPASIMSGRRKANPQDKVHPNKAEFIRAKYQMLAFVHRL
PCRDDDSVTAKDLSKQLHSSVRTGNLETCLRLLSLGAQANFFHPEKGNTPLHVASKAGQI
LQAELLAVYGADPGTQDSSGKTPVDYARQGGHHELAERLVEIQYELTDRLAFYLCGRKPD
HKNGQHFIIPQMADSSLDLSELAKAAKKKLQSLSNHLFEELAMDVYDEVDRRETDAVWLA
TQNHSALVTETTVVPFLPVNPEYSSTRNQGRQKLARFNAHEFATLVIDILSDAKRRQQGS
SLSGSKDNVELILKTINNQHSVESQDNDQPDYDSVASDEDTDLETTASKTNRQKSLDSDL
SDGPVTVQEFMEVKNALVASEAKIQQLMKVNNNLSDELRIMQKKLQTLQSENSNLRKQAT
TNVYQVQTGSEYTDTSNHSSLKRRPSARGSRPMSMYETGSGQKPYLPMGEASRPEESRMR
LQPFPAHIGRSALVTSSSSLPSFPSTLSWSRDESARRASRLEKQNSTPESDYDNTPNDME
PDGMGSSRKGRQRSMVWPGDGLVPDTAEPHVAPSPTLPSTEDVIRKTEQITKNIQELLRA
AQENKHDSYIPCSERIHVAVTEMAALFPKKPKSDMVRTSLRLLTSSAYRLQSECKKTLPG
DPGSPTDVQLVTQQVIQCAYDIAKAAKQLVTITTKENNN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14161	1.000	1.000	1.782E-101	759	1.000	1.000	Q14161.pdb.gz	GIT2_HUMAN ARF GTPase-activating protein GIT2 OS=Homo sapiens OX=9606 GN=GIT2 PE=1 SV=2
2	AFDB:Q9DE64	0.644	0.645	1.753E-88	757	0.895	0.897	Q9DE64.pdb.gz	Q9DE64_CHICK p95-APP2 OS=Gallus gallus OX=9031 GN=p95-APP2 PE=2 SV=1
3	AFDB:Q9JLQ2	0.518	0.554	5.108E-86	708	0.856	0.918	Q9JLQ2.pdb.gz	GIT2_MOUSE ARF GTPase-activating protein GIT2 OS=Mus musculus OX=10090 GN=Git2 PE=1 SV=2
4	AFDB:A2BG45	0.644	0.651	7.714E-75	750	0.718	0.727	A2BG45.pdb.gz	A2BG45_DANRE ARF GTPase-activating protein GIT2 OS=Danio rerio OX=7955 GN=git2 PE=4 SV=1
5	AFDB:A0A0C4DGN6	0.469	0.476	8.887E-71	747	0.661	0.672	A0A0C4DGN6.pdb.gz	A0A0C4DGN6_HUMAN GIT ArfGAP 1 OS=Homo sapiens OX=9606 GN=GIT1 PE=1 SV=1
6	AFDB:Q9DG15	0.465	0.477	2.413E-70	740	0.663	0.680	Q9DG15.pdb.gz	Q9DG15_CHICK p95-APP1 OS=Gallus gallus OX=9031 PE=2 SV=1
7	AFDB:Q68FF6	0.710	0.701	5.220E-70	770	0.675	0.665	Q68FF6.pdb.gz	GIT1_MOUSE ARF GTPase-activating protein GIT1 OS=Mus musculus OX=10090 GN=Git1 PE=1 SV=1
8	AFDB:A0A0R4IPR8	0.466	0.465	1.933E-66	761	0.636	0.635	A0A0R4IPR8.pdb.gz	A0A0R4IPR8_DANRE ARF GTPase-activating protein GIT1 isoform X1 OS=Danio rerio OX=7955 GN=git1 PE=1 SV=1
9	AFDB:Q95RG8	0.462	0.480	1.982E-39	731	0.349	0.363	Q95RG8.pdb.gz	GIT_DROME ARF GTPase-activating protein Git OS=Drosophila melanogaster OX=7227 GN=Git PE=1 SV=1
10	PDB:3lvqE	0.224	0.373	2.321E-9	420	0.083	0.150	3lvqE.pdb.gz	The structure of an Arf-ArfGAP complex reveals a Ca2+ regulatory mechanism
11	AFDB:Q0E917	0.128	0.083	3.236E-4	1200	0.097	0.062	Q0E917.pdb.gz	Q0E917_DROME FI18818p1 OS=Drosophila melanogaster OX=7227 GN=Fak PE=2 SV=1
12	PDB:3ljuX	0.131	0.260	1.010E-3	373	0.041	0.083	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
13	PDB:6mwqA	0.126	0.188	8.532E-3	493	0.051	0.079	6mwqA.pdb.gz
14	PDB:1bd8A	0.119	0.526	1.227E-2	156	0.038	0.186	1bd8A.pdb.gz
15	PDB:5vkqA	0.115	0.063	1.227E-2	1499	0.066	0.033	5vkqA.pdb.gz
16	PDB:2dvwA	0.118	0.373	1.611E-2	229	0.042	0.140	2dvwA.pdb.gz
17	PDB:6jd6B	0.111	0.426	1.686E-2	192	0.037	0.146	6jd6B.pdb.gz
18	PDB:8cs9A	0.112	0.107	1.764E-2	796	0.034	0.033	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
19	PDB:4bszB	0.108	0.514	2.021E-2	150	0.033	0.167	4bszB.pdb.gz
20	PDB:1bu9A	0.109	0.467	2.778E-2	168	0.037	0.167	1bu9A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0C4DGN6	0.0	956	747	0.667	0.677	A0A0C4DGN6_HUMAN GIT ArfGAP 1 OS=Homo sapiens OX=9606 GN=GIT1 PE=1 SV=1
2	A0A0R4IPR8	0.0	911	761	0.657	0.656	A0A0R4IPR8_DANRE ARF GTPase-activating protein GIT1 isoform X1 OS=Danio rerio OX=7955 GN=git1 PE=1 SV=1
3	A2BG45	0.0	1114	750	0.722	0.731	A2BG45_DANRE ARF GTPase-activating protein GIT2 OS=Danio rerio OX=7955 GN=git2 PE=4 SV=1
4	E7FAZ2	0.0	915	752	0.657	0.664	E7FAZ2_DANRE ARF GTPase-activating protein GIT1 isoform X2 OS=Danio rerio OX=7955 GN=git1 PE=1 SV=1
5	J3QRU8	0.0	863	694	0.611	0.669	J3QRU8_HUMAN GIT ArfGAP 1 OS=Homo sapiens OX=9606 GN=GIT1 PE=1 SV=1
6	Q14161	0.0	1583	759	1.000	1.000	GIT2_HUMAN ARF GTPase-activating protein GIT2 OS=Homo sapiens OX=9606 GN=GIT2 PE=1 SV=2
7	Q68FF6	0.0	967	770	0.677	0.668	GIT1_MOUSE ARF GTPase-activating protein GIT1 OS=Mus musculus OX=10090 GN=Git1 PE=1 SV=1
8	Q9DE64	0.0	1402	757	0.895	0.897	Q9DE64_CHICK p95-APP2 OS=Gallus gallus OX=9031 GN=p95-APP2 PE=2 SV=1
9	Q9DG15	0.0	949	740	0.671	0.688	Q9DG15_CHICK p95-APP1 OS=Gallus gallus OX=9031 PE=2 SV=1
10	Q9JLQ2	0.0	1318	708	0.862	0.924	GIT2_MOUSE ARF GTPase-activating protein GIT2 OS=Mus musculus OX=10090 GN=Git2 PE=1 SV=2
11	Q9Y2X7	0.0	969	761	0.677	0.675	GIT1_HUMAN ARF GTPase-activating protein GIT1 OS=Homo sapiens OX=9606 GN=GIT1 PE=1 SV=2
12	Q9Z272	0.0	956	770	0.676	0.666	GIT1_RAT ARF GTPase-activating protein GIT1 OS=Rattus norvegicus OX=10116 GN=Git1 PE=1 SV=1
13	Q95RG8	1.96e-124	390	731	0.299	0.311	GIT_DROME ARF GTPase-activating protein Git OS=Drosophila melanogaster OX=7227 GN=Git PE=1 SV=1
14	Q19467	4.25e-68	239	670	0.203	0.230	Q19467_CAEEL Arf-GAP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=git-1 PE=1 SV=2
15	U6A022	8.59e-33	138	808	0.101	0.095	U6A022_RAT ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 OS=Rattus norvegicus OX=10116 GN=Agap3 PE=2 SV=1
16	Q8VHH5	1.34e-32	137	910	0.101	0.085	AGAP3_MOUSE Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 OS=Mus musculus OX=10090 GN=Agap3 PE=1 SV=1
17	Q9UPQ3	3.92e-31	133	857	0.105	0.093	AGAP1_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=AGAP1 PE=1 SV=4
18	J3KNM6	6.55e-30	129	1036	0.096	0.070	J3KNM6_HUMAN ArfGAP with GTPase domain, ankyrin repeat and PH domain 2 (Fragment) OS=Homo sapiens OX=9606 GN=AGAP2 PE=1 SV=1
19	Q99490	1.21e-29	129	1192	0.096	0.061	AGAP2_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=AGAP2 PE=1 SV=2
20	F8VVT9	1.22e-29	129	1192	0.096	0.061	F8VVT9_HUMAN ArfGAP with GTPase domain, ankyrin repeat and PH domain 2 OS=Homo sapiens OX=9606 GN=AGAP2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	1.2	20.9	Ankyrin repeat
2	PF12796 Ank_2	4.3e-05	35.3	Ankyrin repeats (3 copies)
3	PF13637 Ank_4	0.00098	30.9	Ankyrin repeats (many copies)
4	PF13857 Ank_5	0.00019	32.9	Ankyrin repeats (many copies)
5	PF01412 ArfGap	8.6e-25	98.5	Putative GTPase activating protein for Arf
6	PF08826 DMPK_coil	2.3e+02	13.3	DMPK coiled coil domain like
7	PF12205 GIT1_C	1.2e-31	120.6	G protein-coupled receptor kinase-interacting protein 1 C term
8	PF16559 GIT_CC	1.6e-27	106.3	GIT coiled-coil Rho guanine nucleotide exchange factor
9	PF08518 GIT_SHD	1.8e-23	93.1	Spa2 homology domain (SHD) of GIT
10	PF07558 Shugoshin_N	9.9e+02	11.0	Shugoshin N-terminal coiled-coil region
11	PF14203 TTRAP	1.7e+02	13.9	Putative transposon-transfer assisting protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000347464

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000267257	0.999	Paxillin
2	9606.ENSP00000250617	0.998	Rho guanine nucleotide exchange factor 6
3	9606.ENSP00000364893	0.998	Rho guanine nucleotide exchange factor 7
4	9606.ENSP00000417273	0.989	Cytoplasmic protein NCK1
5	9606.ENSP00000278568	0.983	Serine/threonine-protein kinase PAK 1
6	9606.ENSP00000383118	0.969	Cell division control protein 42 homolog
7	9606.ENSP00000341189	0.961	Focal adhesion kinase 1
8	9606.ENSP00000379975	0.948	Integrin-linked protein kinase
9	9606.ENSP00000314067	0.944	Serine/threonine-protein kinase PAK 2
10	9606.ENSP00000353864	0.944	Serine/threonine-protein kinase PAK 3
11	9606.ENSP00000348461	0.941	Ras-related C3 botulinum toxin substrate 1
12	9606.ENSP00000362680	0.939	Proto-oncogene tyrosine-protein kinase Src
13	9606.ENSP00000233154	0.936	Cytoplasmic protein NCK2
14	9606.ENSP00000365745	0.923	Contributes to the organization of the actin cytoskeleton and cell shape . Plays a role in the formation of lamellipodia and in cell migration. Plays a role in the regulation of neuron morphology, axon growth and formation of neuronal growth cones (By similarity). Through its interaction with CTTNBP2, involved in the regulation of neuronal spine density (By similarity). Plays a role in the invasiveness of cancer cells, and the formation of metastases . Plays a role in focal adhesion assembly and turnover (By similarity). In complex with ABL1 and MYLK regulates cortical actin-based cyto [...]
15	9606.ENSP00000469413	0.920	Serine/threonine-protein kinase PAK 4
16	9606.ENSP00000367686	0.910	Serine/threonine-protein kinase PAK 5
17	9606.ENSP00000258341	0.909	Laminin subunit gamma-1
18	9606.ENSP00000354360	0.909	Laminin subunit gamma-3
19	9606.ENSP00000337825	0.908	Tyrosine-protein kinase Lck
20	9606.ENSP00000346671	0.907	Tyrosine-protein kinase Fyn

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.718	enzyme binding
GO:0098772	0.453	molecular function regulator activity
GO:0030234	0.331	enzyme regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0023051	0.886	regulation of signaling
GO:0010646	0.885	regulation of cell communication
GO:0009987	0.875	cellular process
GO:0050896	0.771	response to stimulus
GO:0048583	0.733	regulation of response to stimulus
GO:0009966	0.705	regulation of signal transduction
GO:0008277	0.684	regulation of G protein-coupled receptor signaling pathway
GO:0048518	0.661	positive regulation of biological process
GO:0032501	0.634	multicellular organismal process
GO:0032502	0.560	developmental process
GO:0048856	0.548	anatomical structure development
GO:0051716	0.536	cellular response to stimulus
GO:0048522	0.514	positive regulation of cellular process
GO:0048519	0.326	negative regulation of biological process
GO:0016043	0.321	cellular component organization
GO:0048523	0.313	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030054	0.997	cell junction
GO:0005829	0.997	cytosol
GO:0043231	0.995	intracellular membrane-bounded organelle
GO:0016020	0.986	membrane
GO:0032991	0.985	protein-containing complex
GO:0071944	0.980	cell periphery
GO:0070161	0.978	anchoring junction
GO:0030055	0.969	cell-substrate junction
GO:0005634	0.966	nucleus
GO:0005925	0.953	focal adhesion
GO:0070013	0.938	intracellular organelle lumen
GO:0005886	0.915	plasma membrane
GO:0031981	0.714	nuclear lumen
GO:0005654	0.695	nucleoplasm
GO:0042995	0.667	cell projection
GO:0120025	0.664	plasma membrane bounded cell projection
GO:0045202	0.374	synapse
GO:0043005	0.342	neuron projection
GO:0043232	0.318	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]