StarFunc result for job id Q14164

User Input

>input (716 residues)
MQSTANYLWHTDDLLGQGATASVYKARNKKSGELVAVKVFNTTSYLRPREVQVREFEVLR
KLNHQNIVKLFAVEETGGSRQKVLVMEYCSSGSLLSVLESPENAFGLPEDEFLVVLRCVV
AGMNHLRENGIVHRDIKPGNIMRLVGEEGQSIYKLTDFGAARELDDDEKFVSVYGTEEYL
HPDMYERAVLRKPQQKAFGVTVDLWSIGVTLYHAATGSLPFIPFGGPRRNKEIMYRITTE
KPAGAIAGAQRRENGPLEWSYTLPITCQLSLGLQSQLVPILANILEVEQAKCWGFDQFFA
ETSDILQRVVVHVFSLSQAVLHHIYIHAHNTIAIFQEAVHKQTSVAPRHQEYLFEGHLCV
LEPSVSAQHIAHTTASSPLTLFSTAIPKGLAFRDPALDVPKFVPKVDLQADYNTAKGVLG
AGYQALRLARALLDGQELMFRGLHWVMEVLQATCRRTLEVARTSLLYLSSSLGTERFSSV
AGTPEIQELKAAAELRSRLRTLAEVLSRCSQNITETQESLSSLNRELVKSRDQVHEDRSI
QQIQCCLDKMNFIYKQFKKSRMRPGLGYNEEQIHKLDKVNFSHLAKRLLQVFQEECVQKY
QASLVTHGKRMRVVHETRNHLRLVGCSVAACNTEAQGVQESLSKLLEELSHQLLQDRAKG
AQASPPPIAPYPSPTRKDLLLHMQELCEGMKLLASDLLDNNRIIERLNRVPAPPDV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14164	1.000	1.000	0.000	716	1.000	1.000	Q14164.pdb.gz	IKKE_HUMAN Inhibitor of nuclear factor kappa-B kinase subunit epsilon OS=Homo sapiens OX=9606 GN=IKBKE PE=1 SV=1
2	AFDB:Q9R0T8	0.974	0.972	0.000	717	0.835	0.834	Q9R0T8.pdb.gz	IKKE_MOUSE Inhibitor of nuclear factor kappa-B kinase subunit epsilon OS=Mus musculus OX=10090 GN=Ikbke PE=1 SV=2
3	AFDB:Q0GKD6	0.892	0.879	3.630E-77	727	0.506	0.498	Q0GKD6.pdb.gz	Q0GKD6_DANRE Serine/threonine-protein kinase TBK1 OS=Danio rerio OX=7955 GN=wu:fk70c05 PE=1 SV=1
4	AFDB:A7UNK0	0.855	0.841	9.119E-77	729	0.485	0.476	A7UNK0.pdb.gz
5	PDB:6o8bB	0.846	0.920	5.161E-69	657	0.462	0.504	6o8bB.pdb.gz	A conserved PLPLRT/SD motif of STING mediates the recruitment and activation of TBK1.
6	AFDB:A0A494C0X2	0.740	0.819	1.119E-64	643	0.444	0.495	A0A494C0X2.pdb.gz	A0A494C0X2_HUMAN TANK binding kinase 1 OS=Homo sapiens OX=9606 GN=TBK1 PE=1 SV=1
7	AFDB:Q86PE7	0.803	0.799	2.291E-64	720	0.358	0.356	Q86PE7.pdb.gz	Q86PE7_DROME SD10041p OS=Drosophila melanogaster OX=7227 GN=IKKepsilon PE=1 SV=1
8	PDB:4im0A	0.778	0.895	6.019E-63	619	0.432	0.499	4im0A.pdb.gz	Structure and ubiquitination-dependent activation of TANK-binding kinase 1.
9	PDB:6o8cA	0.802	0.900	5.434E-60	636	0.436	0.491	6o8cA.pdb.gz	A conserved PLPLRT/SD motif of STING mediates the recruitment and activation of TBK1.
10	AFDB:Q1JPV3	0.428	0.838	1.375E-46	365	0.327	0.641	Q1JPV3.pdb.gz
11	AFDB:Q4G3H4	0.545	0.521	1.241E-35	758	0.218	0.206	Q4G3H4.pdb.gz	IKKA_DANRE Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Danio rerio OX=7955 GN=chuk PE=1 SV=1
12	AFDB:B0R199	0.574	0.538	1.447E-35	779	0.225	0.207	B0R199.pdb.gz
13	AFDB:Q5ZJB4	0.500	0.482	6.382E-35	759	0.194	0.183	Q5ZJB4.pdb.gz	IKKA_CHICK Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Gallus gallus OX=9031 GN=CHUK PE=2 SV=1
14	PDB:5u6yA	0.324	0.493	8.195E-15	459	0.091	0.142	5u6yA.pdb.gz
15	PDB:2yaaA	0.322	0.725	1.439E-14	300	0.108	0.257	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
16	PDB:1unlA	0.301	0.686	1.594E-14	292	0.096	0.236	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
17	PDB:6qx9K	0.303	0.633	2.058E-14	322	0.102	0.227	6qx9K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
18	PDB:4krcA	0.319	0.722	2.280E-14	297	0.102	0.246	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
19	PDB:4eomC	0.318	0.772	4.913E-14	276	0.102	0.264	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
20	PDB:4zhxA	0.294	0.497	7.786E-14	409	0.096	0.169	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A494C0X2	0.0	611	643	0.454	0.505	A0A494C0X2_HUMAN TANK binding kinase 1 OS=Homo sapiens OX=9606 GN=TBK1 PE=1 SV=1
2	A0A494C148	0.0	669	705	0.473	0.481	A0A494C148_HUMAN TANK binding kinase 1 OS=Homo sapiens OX=9606 GN=TBK1 PE=1 SV=1
3	A0A494C167	0.0	615	677	0.447	0.473	A0A494C167_HUMAN TANK binding kinase 1 OS=Homo sapiens OX=9606 GN=TBK1 PE=1 SV=1
4	Q0GKD6	0.0	680	727	0.504	0.497	Q0GKD6_DANRE Serine/threonine-protein kinase TBK1 OS=Danio rerio OX=7955 GN=wu:fk70c05 PE=1 SV=1
5	Q14164	0.0	1485	716	1.000	1.000	IKKE_HUMAN Inhibitor of nuclear factor kappa-B kinase subunit epsilon OS=Homo sapiens OX=9606 GN=IKBKE PE=1 SV=1
6	Q9R0T8	0.0	1249	717	0.835	0.834	IKKE_MOUSE Inhibitor of nuclear factor kappa-B kinase subunit epsilon OS=Mus musculus OX=10090 GN=Ikbke PE=1 SV=2
7	Q9UHD2	0.0	686	729	0.492	0.483	TBK1_HUMAN Serine/threonine-protein kinase TBK1 OS=Homo sapiens OX=9606 GN=TBK1 PE=1 SV=1
8	Q9WUN2	0.0	681	729	0.490	0.481	TBK1_MOUSE Serine/threonine-protein kinase TBK1 OS=Mus musculus OX=10090 GN=Tbk1 PE=1 SV=1
9	Q9V3Y8	2.34e-151	459	720	0.356	0.354	Q9V3Y8_DROME FI05319p OS=Drosophila melanogaster OX=7227 GN=IKKepsilon PE=2 SV=2
10	Q86PE7	2.50e-151	459	720	0.356	0.354	Q86PE7_DROME SD10041p OS=Drosophila melanogaster OX=7227 GN=IKKepsilon PE=1 SV=1
11	Q7KJQ4	8.59e-150	454	711	0.355	0.357	Q7KJQ4_DROME Protein kinase DIK2 OS=Drosophila melanogaster OX=7227 GN=IKKepsilon PE=2 SV=1
12	Q5ZJB4	2.28e-39	157	759	0.154	0.145	IKKA_CHICK Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Gallus gallus OX=9031 GN=CHUK PE=2 SV=1
13	Q9QY78	3.01e-37	151	757	0.148	0.140	IKKB_RAT Inhibitor of nuclear factor kappa-B kinase subunit beta OS=Rattus norvegicus OX=10116 GN=Ikbkb PE=1 SV=1
14	O88351	4.91e-37	150	757	0.149	0.141	IKKB_MOUSE Inhibitor of nuclear factor kappa-B kinase subunit beta OS=Mus musculus OX=10090 GN=Ikbkb PE=1 SV=1
15	O14920	5.50e-37	150	756	0.145	0.138	IKKB_HUMAN Inhibitor of nuclear factor kappa-B kinase subunit beta OS=Homo sapiens OX=9606 GN=IKBKB PE=1 SV=1
16	Q4G3H4	1.30e-35	146	758	0.229	0.216	IKKA_DANRE Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Danio rerio OX=7955 GN=chuk PE=1 SV=1
17	Q60680	6.11e-33	138	745	0.141	0.136	IKKA_MOUSE Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Mus musculus OX=10090 GN=Chuk PE=1 SV=1
18	O15111	3.13e-32	135	745	0.141	0.136	IKKA_HUMAN Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Homo sapiens OX=9606 GN=CHUK PE=1 SV=2
19	A0A8I6ANR6	9.19e-32	134	713	0.140	0.140	A0A8I6ANR6_RAT IkappaB kinase OS=Rattus norvegicus OX=10116 GN=Chuk PE=1 SV=1
20	G3V926	1.12e-31	133	680	0.140	0.147	G3V926_RAT IkappaB kinase OS=Rattus norvegicus OX=10116 GN=Chuk PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	4.2e-05	34.3	ABC1 atypical kinase-like domain
2	PF01636 APH	11	17.3	Phosphotransferase enzyme family
3	PF19111 DUF5798	6.1e+02	12.0	Family of unknown function (DUF5798)
4	PF14531 Kinase-like	1.2	20.0	Kinase-like
5	PF00069 Pkinase	8.2e-43	158.3	Protein kinase domain
6	PF17667 Pkinase_fungal	0.012	26.0	Fungal protein kinase
7	PF07714 PK_Tyr_Ser-Thr	3.3e-25	100.4	Protein tyrosine and serine/threonine kinase
8	PF01163 RIO1	31	15.6	RIO1 family
9	PF18394 TBK1_CCD1	5e-78	273.7	TANK-binding kinase 1 coiled-coil domain 1
10	PF18396 TBK1_ULD	2.6e-28	109.1	TANK binding kinase 1 ubiquitin-like domain
11	PF13901 zf-RING_9	14	17.1	Putative zinc-RING and/or ribbon

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000464030

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376505	0.997	TRAF family member-associated NF-kappa-B activator
2	9606.ENSP00000454207	0.996	TNF receptor-associated factor 3
3	9606.ENSP00000401980	0.995	Mitochondrial antiviral-signaling protein
4	9606.ENSP00000471896	0.991	Interferon regulatory factor 3
5	9606.ENSP00000329967	0.987	Serine/threonine-protein kinase TBK1
6	9606.ENSP00000380697	0.976	Interferon regulatory factor 7
7	9606.ENSP00000483825	0.969	NF-kappa-B essential modulator
8	9606.ENSP00000331288	0.965	Stimulator of interferon genes protein
9	9606.ENSP00000392025	0.964	Ubiquitin carboxyl-terminal hydrolase CYLD
10	9606.ENSP00000398698	0.953	Tumor necrosis factor
11	9606.ENSP00000419371	0.946	5-azacytidine-induced protein 2
12	9606.ENSP00000433623	0.937	TNF receptor-associated factor 6
13	9606.ENSP00000247668	0.933	TNF receptor-associated factor 2
14	9606.ENSP00000358541	0.933	Suppressor of IKBKE 1
15	9606.ENSP00000353735	0.927	E3 ubiquitin-protein ligase Topors
16	9606.ENSP00000348056	0.915	SUMO-conjugating enzyme UBC9
17	9606.ENSP00000369213	0.912	Probable ATP-dependent RNA helicase DDX58
18	9606.ENSP00000340944	0.909	Tyrosine-protein phosphatase non-receptor type 11
19	9606.ENSP00000441543	0.906	Polyubiquitin-C
20	9606.ENSP00000354394	0.904	Signal transducer and activator of transcription 1-alpha/beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0019899	0.998	enzyme binding
GO:0031593	0.990	polyubiquitin modification-dependent protein binding
GO:0044389	0.987	ubiquitin-like protein ligase binding
GO:0031625	0.981	ubiquitin protein ligase binding
GO:0036435	0.962	K48-linked polyubiquitin modification-dependent protein binding
GO:0042802	0.711	identical protein binding
GO:1901363	0.342	heterocyclic compound binding
GO:0097159	0.342	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0048518	0.995	positive regulation of biological process
GO:0048583	0.993	regulation of response to stimulus
GO:0050896	0.992	response to stimulus
GO:0023051	0.992	regulation of signaling
GO:0010646	0.992	regulation of cell communication
GO:0060255	0.988	regulation of macromolecule metabolic process
GO:0044238	0.986	primary metabolic process
GO:0043170	0.985	macromolecule metabolic process
GO:0048522	0.984	positive regulation of cellular process
GO:0009966	0.984	regulation of signal transduction
GO:0031323	0.983	regulation of cellular metabolic process
GO:0051716	0.981	cellular response to stimulus
GO:0080090	0.981	regulation of primary metabolic process
GO:0051171	0.981	regulation of nitrogen compound metabolic process
GO:0007154	0.979	cell communication
GO:0023052	0.978	signaling
GO:0048584	0.978	positive regulation of response to stimulus
GO:0019538	0.978	protein metabolic process
GO:0010468	0.975	regulation of gene expression
GO:0043412	0.971	macromolecule modification
GO:0009967	0.963	positive regulation of signal transduction
GO:0019219	0.956	regulation of nucleobase-containing compound metabolic process
GO:0048519	0.950	negative regulation of biological process
GO:0051252	0.948	regulation of RNA metabolic process
GO:0006950	0.946	response to stress
GO:0010604	0.935	positive regulation of macromolecule metabolic process
GO:0007165	0.933	signal transduction
GO:0036211	0.932	protein modification process
GO:0044237	0.919	cellular metabolic process
GO:0043122	0.914	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0016310	0.908	phosphorylation
GO:0006468	0.901	protein phosphorylation
GO:0042221	0.862	response to chemical
GO:0060759	0.862	regulation of response to cytokine stimulus
GO:0034097	0.841	response to cytokine
GO:0009894	0.774	regulation of catabolic process
GO:0006355	0.755	regulation of DNA-templated transcription
GO:0002682	0.743	regulation of immune system process
GO:0009605	0.742	response to external stimulus
GO:0044419	0.737	biological process involved in interspecies interaction between organisms
GO:0009607	0.708	response to biotic stimulus
GO:0048523	0.672	negative regulation of cellular process
GO:0051707	0.671	response to other organism
GO:0009892	0.637	negative regulation of metabolic process
GO:0065009	0.636	regulation of molecular function
GO:0051239	0.629	regulation of multicellular organismal process
GO:1902533	0.629	positive regulation of intracellular signal transduction
GO:0002376	0.628	immune system process
GO:0080134	0.628	regulation of response to stress
GO:0010628	0.576	positive regulation of gene expression
GO:0050776	0.569	regulation of immune response
GO:0045088	0.560	regulation of innate immune response
GO:0051173	0.555	positive regulation of nitrogen compound metabolic process
GO:0050778	0.549	positive regulation of immune response
GO:0070887	0.547	cellular response to chemical stimulus
GO:0010605	0.531	negative regulation of macromolecule metabolic process
GO:0035556	0.529	intracellular signal transduction
GO:0031349	0.527	positive regulation of defense response
GO:0032103	0.503	positive regulation of response to external stimulus
GO:0001817	0.495	regulation of cytokine production
GO:0001819	0.483	positive regulation of cytokine production
GO:0044093	0.477	positive regulation of molecular function
GO:0051090	0.476	regulation of DNA-binding transcription factor activity
GO:0006915	0.475	apoptotic process
GO:0031325	0.475	positive regulation of cellular metabolic process
GO:0006952	0.468	defense response
GO:0009615	0.468	response to virus
GO:0071310	0.463	cellular response to organic substance
GO:0033554	0.452	cellular response to stress
GO:0098542	0.450	defense response to other organism
GO:0071345	0.447	cellular response to cytokine stimulus
GO:0043123	0.444	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0006955	0.439	immune response
GO:0002833	0.438	positive regulation of response to biotic stimulus
GO:0045089	0.429	positive regulation of innate immune response
GO:0007166	0.424	cell surface receptor signaling pathway
GO:0051091	0.390	positive regulation of DNA-binding transcription factor activity
GO:0051246	0.354	regulation of protein metabolic process
GO:0001959	0.344	regulation of cytokine-mediated signaling pathway
GO:0045087	0.344	innate immune response
GO:0031329	0.300	regulation of cellular catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0031981	0.996	nuclear lumen
GO:0005654	0.992	nucleoplasm
GO:0016020	0.978	membrane
GO:0031090	0.857	organelle membrane
GO:0012505	0.478	endomembrane system
GO:0005739	0.392	mitochondrion
GO:0031967	0.302	organelle envelope

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]