StarFunc result for job id Q14166

User Input

>input (644 residues)
MEAERGPERRPAERSSPGQTPEEGAQALAEFAALHGPALRASGVPERYWGRLLHKLEHEV
FDAGEVFGIMQVEEVEEEEDEAAREVRKQQPNPGNELCYKVIVTRESGLQAAHPNSIFLI
DHAWTCRVEHARQQLQQVPGLLHRMANLMGIEFHGELPSTEAVALVLEEMWKFNQTYQLA
HGTAEEKMPVWYIMDEFGSRIQHADVPSFATAPFFYMPQQVAYTLLWPLRDLDTGEEVTR
DFAYGETDPLIRKCMLLPWAPTDMLDLSSCTPEPPAEHYQAILEENKEKLPLDINPVVHP
HGHIFKVYTDVQQVASSLTHPRFTLTQSEADADILFNFSHFKDYRKLSQERPGVLLNQFP
CENLLTVKDCLASIARRAGGPEGPPWLPRTFNLRTELPQFVSYFQQRERWGEDNHWICKP
WNLARSLDTHVTKSLHSIIRHRESTPKVVSKYIESPVLFLREDVGKVKFDIRYIVLLRSV
RPLRLFVYDVFWLRFSNRAFALNDLDDYEKHFTVMNYDPDVVLKQVHCEEFIPEFEKQYP
EFPWTDVQAEIFRAFTELFQVACAKPPPLGLCDYPSSRAMYAVDLMLKWDNGPDGRRVMQ
PQILEVNFNPDCERACRYHPTFFNDVFSTLFLDQPGGCHVTCLV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14166	1.000	1.000	0.000	644	1.000	1.000	Q14166.pdb.gz	TTL12_HUMAN Tubulin--tyrosine ligase-like protein 12 OS=Homo sapiens OX=9606 GN=TTLL12 PE=1 SV=2
2	AFDB:Q09512	0.829	0.808	9.599E-62	662	0.357	0.347	Q09512.pdb.gz	TTL12_CAEEL Tubulin--tyrosine ligase-like protein 12 OS=Caenorhabditis elegans OX=6239 GN=ttll-12 PE=3 SV=1
3	AFDB:Q386R8	0.747	0.745	3.749E-47	646	0.270	0.269	Q386R8.pdb.gz	Q386R8_TRYB2 Tubulin-tyrosine ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.0020 PE=4 SV=1
4	AFDB:A2APC3	0.420	0.576	1.531E-18	461	0.116	0.163	A2APC3.pdb.gz	TTLL9_MOUSE Probable tubulin polyglutamylase TTLL9 OS=Mus musculus OX=10090 GN=Ttll9 PE=1 SV=2
5	AFDB:Q8CHB8	0.425	0.212	6.041E-18	1328	0.115	0.056	Q8CHB8.pdb.gz	TTLL5_MOUSE Tubulin polyglutamylase TTLL5 OS=Mus musculus OX=10090 GN=Ttll5 PE=1 SV=3
6	AFDB:Q6EMB2	0.425	0.220	7.122E-18	1281	0.115	0.058	Q6EMB2.pdb.gz	TTLL5_HUMAN Tubulin polyglutamylase TTLL5 OS=Homo sapiens OX=9606 GN=TTLL5 PE=1 SV=3
7	AFDB:Q384Y9	0.406	0.273	6.060E-17	980	0.102	0.067	Q384Y9.pdb.gz	Q384Y9_TRYB2 Tubulin-tyrsoine ligase-like protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.4640 PE=4 SV=1
8	AFDB:Q23SI8	0.420	0.638	7.145E-17	413	0.104	0.162	Q23SI8.pdb.gz	TTLL1_TETTS Probable alpha-tubulin polyglutamylase Ttll1 OS=Tetrahymena thermophila (strain SB210) OX=312017 GN=Ttll1 PE=3 SV=2
9	AFDB:F7E540	0.408	0.296	8.424E-17	909	0.112	0.079	F7E540.pdb.gz	TTLL7_XENTR Tubulin polyglutamylase TTLL7 OS=Xenopus tropicalis OX=8364 GN=ttll7 PE=1 SV=2
10	AFDB:Q09647	0.407	0.433	1.171E-16	601	0.096	0.103	Q09647.pdb.gz	TTLL4_CAEEL Tubulin polyglutamylase ttll-4 OS=Caenorhabditis elegans OX=6239 GN=ttll-4 PE=1 SV=3
11	PDB:8asnG	0.410	0.726	3.127E-15	346	0.085	0.159	8asnG.pdb.gz	Crystal structure of the apo human TTL in complex with tubulin-stathmin
12	PDB:8asnF	0.395	0.757	8.401E-15	317	0.085	0.174	8asnF.pdb.gz	Crystal structure of the apo human TTL in complex with tubulin-stathmin
13	PDB:3lwbB	0.297	0.562	4.460E-7	298	0.084	0.181	3lwbB.pdb.gz
14	PDB:3lwbA	0.290	0.509	2.315E-6	323	0.082	0.164	3lwbA.pdb.gz
15	PDB:3vpbB	0.269	0.527	1.019E-5	282	0.078	0.177	3vpbB.pdb.gz	Lysine and arginine biosyntheses mediated by a common carrier protein in Sulfolobus
16	PDB:4c5aA	0.275	0.501	1.270E-5	306	0.084	0.176	4c5aA.pdb.gz	Inhibition of D-Ala:D-Ala ligase through a phosphorylated form of the antibiotic D-cycloserine.
17	PDB:7tn8A	0.282	0.555	1.970E-5	281	0.062	0.142	7tn8A.pdb.gz	Structural and catalytic analyses of the InsP 6 kinase activities of higher plant ITPKs.
18	PDB:5cskA	0.215	0.085	5.591E-5	1996	0.056	0.018	5cskA.pdb.gz
19	PDB:1e4eA	0.266	0.457	6.964E-5	341	0.065	0.123	1e4eA.pdb.gz	The molecular basis of vancomycin resistance in clinically relevant Enterococci: crystal structure of D-alanyl-D-lactate ligase (VanA).
20	PDB:6jilB	0.283	0.536	1.676E-4	298	0.068	0.148	6jilB.pdb.gz	Cyclization mechanism catalyzed by an ATP-grasp enzyme essential for d-cycloserine biosynthesis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14166	0.0	1340	644	1.000	1.000	TTL12_HUMAN Tubulin--tyrosine ligase-like protein 12 OS=Homo sapiens OX=9606 GN=TTLL12 PE=1 SV=2
2	Q09512	7.29e-119	370	662	0.366	0.356	TTL12_CAEEL Tubulin--tyrosine ligase-like protein 12 OS=Caenorhabditis elegans OX=6239 GN=ttll-12 PE=3 SV=1
3	Q386R8	2.31e-61	218	646	0.290	0.289	Q386R8_TRYB2 Tubulin-tyrosine ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.0020 PE=4 SV=1
4	Q23AS2	2.45e-11	69.7	1394	0.099	0.046	TTL3E_TETTS Tubulin glycylase 3E OS=Tetrahymena thermophila (strain SB210) OX=312017 GN=TTLL3E PE=3 SV=1
5	Q23K29	3.66e-11	68.9	1034	0.113	0.071	TTL3D_TETTS Tubulin glycylase 3D OS=Tetrahymena thermophila (strain SB210) OX=312017 GN=TTLL3D PE=3 SV=2
6	A8CVX7	5.31e-09	61.6	778	0.121	0.100	TTLL6_DANRE Tubulin polyglutamylase ttll6 OS=Danio rerio OX=7955 GN=ttll6 PE=2 SV=1
7	A2APC3	7.13e-09	60.8	461	0.073	0.102	TTLL9_MOUSE Probable tubulin polyglutamylase TTLL9 OS=Mus musculus OX=10090 GN=Ttll9 PE=1 SV=2
8	Q23FE2	4.89e-08	58.9	1065	0.079	0.048	TTL3C_TETTS Tubulin glycylase 3C OS=Tetrahymena thermophila (strain SB210) OX=312017 GN=TTLL3C PE=3 SV=2
9	Q8IPB2	1.58e-07	57.0	1071	0.073	0.044	Q8IPB2_DROME Tubulin tyrosine ligase-like 4A, isoform D OS=Drosophila melanogaster OX=7227 GN=TTLL4A PE=4 SV=2
10	M9NCT3	1.63e-07	57.0	827	0.073	0.057	M9NCT3_DROME Tubulin tyrosine ligase-like 4A, isoform K OS=Drosophila melanogaster OX=7227 GN=TTLL4A PE=4 SV=1
11	Q9VKL9	1.70e-07	57.0	828	0.073	0.057	Q9VKL9_DROME Tubulin tyrosine ligase-like 4A, isoform E OS=Drosophila melanogaster OX=7227 GN=TTLL4A PE=4 SV=2
12	Q8IGW4	1.75e-07	57.0	828	0.073	0.057	Q8IGW4_DROME RE12363p OS=Drosophila melanogaster OX=7227 GN=TTLL4A PE=2 SV=1
13	M9NEE5	1.92e-07	57.0	1070	0.073	0.044	M9NEE5_DROME Tubulin tyrosine ligase-like 4A, isoform I OS=Drosophila melanogaster OX=7227 GN=TTLL4A PE=4 SV=1
14	A6NNM8	2.15e-07	56.6	815	0.073	0.058	TTL13_HUMAN Tubulin polyglutamylase TTLL13 OS=Homo sapiens OX=9606 GN=TTLL13 PE=1 SV=2
15	Q8N841	3.91e-07	55.8	843	0.071	0.055	TTLL6_HUMAN Tubulin polyglutamylase TTLL6 OS=Homo sapiens OX=9606 GN=TTLL6 PE=1 SV=2
16	Q8CHB8	4.28e-07	55.8	1328	0.093	0.045	TTLL5_MOUSE Tubulin polyglutamylase TTLL5 OS=Mus musculus OX=10090 GN=Ttll5 PE=1 SV=3
17	A4Q9E8	4.68e-07	55.5	822	0.073	0.057	TTLL6_MOUSE Tubulin polyglutamylase TTLL6 OS=Mus musculus OX=10090 GN=Ttll6 PE=1 SV=1
18	Q9VM92	5.16e-07	55.5	756	0.054	0.046	TTL3B_DROME Tubulin glycylase 3B OS=Drosophila melanogaster OX=7227 GN=TTLL3B PE=1 SV=2
19	Q6EMB2	6.40e-07	55.5	1281	0.090	0.045	TTLL5_HUMAN Tubulin polyglutamylase TTLL5 OS=Homo sapiens OX=9606 GN=TTLL5 PE=1 SV=3
20	F7E540	6.92e-07	55.1	909	0.064	0.045	TTLL7_XENTR Tubulin polyglutamylase TTLL7 OS=Xenopus tropicalis OX=8364 GN=ttll7 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03133 TTL	4.8e-74	260.7	Tubulin-tyrosine ligase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000216129

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000321346	0.846	Tubulin polyglutamylase TTLL11
2	9606.ENSP00000368592	0.836	Inactive polyglycylase TTLL10
3	9606.ENSP00000375951	0.816	Tubulin polyglutamylase TTLL4
4	9606.ENSP00000266254	0.811	Probable tubulin polyglutamylase TTLL1
5	9606.ENSP00000339063	0.785	Elongation factor 1-alpha 1
6	9606.ENSP00000362456	0.785	Protein PBDC1
7	9606.ENSP00000217182	0.782	Elongation factor 1-alpha 2
8	9606.ENSP00000339179	0.749	Testis-specific serine/threonine-protein kinase 4
9	9606.ENSP00000254322	0.745	DnaJ homolog subfamily B member 1
10	9606.ENSP00000442515	0.740	Probable tubulin polyglutamylase TTLL9
11	9606.ENSP00000376708	0.707	Von Willebrand factor A domain containing 2
12	9606.ENSP00000380903	0.680	Roundabout homolog 3
13	9606.ENSP00000372206	0.678	EEF1A lysine methyltransferase 1
14	9606.ENSP00000233336	0.663	Tubulin--tyrosine ligase
15	9606.ENSP00000359799	0.658	DnaJ homolog subfamily B member 4
16	9606.ENSP00000392252	0.658	Protein monoglycylase TTLL8
17	9606.ENSP00000312318	0.655	Sjoegren syndrome/scleroderma autoantigen 1
18	9606.ENSP00000324422	0.650	Zyxin
19	9606.ENSP00000417378	0.644	ATPase H+ transporting V1 subunit F
20	9606.ENSP00000348838	0.640	Ubiquitin-conjugating enzyme E2 C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0015631	1.000	tubulin binding
GO:0035064	1.000	methylated histone binding
GO:0003824	0.975	catalytic activity
GO:0140096	0.969	catalytic activity, acting on a protein
GO:0016879	0.918	ligase activity, forming carbon-nitrogen bonds
GO:1990889	0.912	H4K20me3 modified histone binding
GO:0016881	0.885	acid-amino acid ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0048583	0.966	regulation of response to stimulus
GO:0048523	0.915	negative regulation of cellular process
GO:0032102	0.910	negative regulation of response to external stimulus
GO:0031348	0.909	negative regulation of defense response
GO:0002832	0.906	negative regulation of response to biotic stimulus
GO:0009966	0.905	regulation of signal transduction
GO:0045824	0.903	negative regulation of innate immune response
GO:0001959	0.902	regulation of cytokine-mediated signaling pathway
GO:0009968	0.882	negative regulation of signal transduction
GO:0060761	0.878	negative regulation of response to cytokine stimulus
GO:0060338	0.874	regulation of type I interferon-mediated signaling pathway
GO:0051726	0.783	regulation of cell cycle
GO:0007346	0.769	regulation of mitotic cell cycle
GO:0001960	0.751	negative regulation of cytokine-mediated signaling pathway
GO:0008152	0.671	metabolic process
GO:0071704	0.645	organic substance metabolic process
GO:0009987	0.643	cellular process
GO:0044238	0.557	primary metabolic process
GO:0006807	0.540	nitrogen compound metabolic process
GO:0043170	0.517	macromolecule metabolic process
GO:1901564	0.511	organonitrogen compound metabolic process
GO:0019538	0.499	protein metabolic process
GO:0036211	0.477	protein modification process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043226	0.937	organelle
GO:0043227	0.933	membrane-bounded organelle
GO:0043229	0.933	intracellular organelle
GO:0005829	0.898	cytosol
GO:0043231	0.773	intracellular membrane-bounded organelle
GO:0005634	0.648	nucleus
GO:0070013	0.605	intracellular organelle lumen
GO:0031981	0.523	nuclear lumen
GO:0005654	0.388	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.3.-.-	0.918	Forming carbon-nitrogen bonds.
EC:6.3.2.-	0.885	Acid--amino-acid ligases (peptide synthases).

[back to server]