StarFunc result for job id Q14184

User Input

>input (412 residues)
MTLRRRGEKATISIQEHMAIDVCPGPIRPIKQISDYFPRFPRGLPPDAGPRAAAPPDAPA
RPAVAGAGRRSPSDGAREDDEDVDQLFGAYGSSPGPSPGPSPARPPAKPPEDEPDADGYE
SDDCTALGTLDFSLLYDQENNALHCTITKAKGLKPMDHNGLADPYVKLHLLPGASKANKL
RTKTLRNTLNPTWNETLTYYGITDEDMIRKTLRISVCDEDKFRHNEFIGETRVPLKKLKP
NHTKTFSICLEKQLPVDKTEDKSLEERGRILISLKYSSQKQGLLVGIVRCAHLAAMDANG
YSDPYVKTYLRPDVDKKSKHKTAVKKKTLNPEFNEEFCYEIKHGDLAKKSLEVTVWDYDI
GKSNDFIGGVVLGIHAKGERLKHWFDCLKNKDKRIERWHTLTSELPGAVLSD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P70169	0.849	0.849	8.231E-67	412	0.951	0.951	P70169.pdb.gz	DOC2B_MOUSE Double C2-like domain-containing protein beta OS=Mus musculus OX=10090 GN=Doc2b PE=1 SV=2
2	AFDB:Q9Y2J0	0.674	0.405	4.932E-50	694	0.612	0.363	Q9Y2J0.pdb.gz	RP3A_HUMAN Rabphilin-3A OS=Homo sapiens OX=9606 GN=RPH3A PE=1 SV=1
3	AFDB:P47709	0.674	0.411	4.392E-49	684	0.600	0.361	P47709.pdb.gz	RP3A_RAT Rabphilin-3A OS=Rattus norvegicus OX=10116 GN=Rph3a PE=1 SV=1
4	AFDB:Q7TNF0	0.653	0.664	7.393E-49	405	0.633	0.644	Q7TNF0.pdb.gz	DOC2A_MOUSE Double C2-like domain-containing protein alpha OS=Mus musculus OX=10090 GN=Doc2a PE=2 SV=1
5	AFDB:Q9ESN1	0.671	0.714	9.919E-43	387	0.500	0.532	Q9ESN1.pdb.gz	DOC2G_MOUSE Double C2-like domain-containing protein gamma OS=Mus musculus OX=10090 GN=Doc2g PE=2 SV=1
6	AFDB:D4P8S0	0.332	0.281	1.828E-32	488	0.291	0.246	D4P8S0.pdb.gz	D4P8S0_DANRE Synaptotagmin VIIb OS=Danio rerio OX=7955 GN=syt7 PE=2 SV=1
7	AFDB:O43581	0.330	0.337	2.005E-31	403	0.284	0.290	O43581.pdb.gz	SYT7_HUMAN Synaptotagmin-7 OS=Homo sapiens OX=9606 GN=SYT7 PE=1 SV=3
8	AFDB:Q9V4C4	0.333	0.330	5.391E-31	416	0.269	0.267	Q9V4C4.pdb.gz	Q9V4C4_DROME Synaptotagmin 7, isoform A OS=Drosophila melanogaster OX=7227 GN=Syt7 PE=1 SV=4
9	AFDB:P21521	0.346	0.303	2.708E-30	474	0.284	0.247	P21521.pdb.gz	SY65_DROME Synaptotagmin 1 OS=Drosophila melanogaster OX=7227 GN=Syt1 PE=1 SV=3
10	AFDB:P29101	0.335	0.327	4.327E-30	422	0.301	0.294	P29101.pdb.gz	SYT2_RAT Synaptotagmin-2 OS=Rattus norvegicus OX=10116 GN=Syt2 PE=1 SV=1
11	PDB:3pfqA	0.286	0.229	5.562E-11	523	0.131	0.103	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
12	PDB:6kxkD	0.199	0.152	4.839E-8	553	0.121	0.090	6kxkD.pdb.gz	Crystal Structure of an Arabidopsis Copine providing insights into this protein family
13	PDB:5iz5B	0.226	0.129	5.959E-8	746	0.087	0.048	5iz5B.pdb.gz
14	PDB:5ixcA	0.231	0.146	4.782E-7	684	0.090	0.054	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
15	PDB:5iz5A	0.206	0.118	6.885E-7	757	0.078	0.042	5iz5A.pdb.gz
16	PDB:5izrC	0.221	0.144	4.726E-6	659	0.102	0.064	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
17	PDB:5a50A	0.192	0.463	2.924E-5	165	0.087	0.218	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
18	PDB:4rj9A	0.185	0.451	5.184E-5	161	0.073	0.186	4rj9A.pdb.gz
19	PDB:5a52A	0.186	0.479	1.468E-4	154	0.078	0.208	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
20	PDB:1cjyA	0.206	0.137	2.472E-4	633	0.063	0.041	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P70169	0.0	738	412	0.951	0.951	DOC2B_MOUSE Double C2-like domain-containing protein beta OS=Mus musculus OX=10090 GN=Doc2b PE=1 SV=2
2	P70610	0.0	788	412	0.954	0.954	DOC2B_RAT Double C2-like domain-containing protein beta OS=Rattus norvegicus OX=10116 GN=Doc2b PE=1 SV=2
3	Q14183	1.99e-173	492	400	0.621	0.640	DOC2A_HUMAN Double C2-like domain-containing protein alpha OS=Homo sapiens OX=9606 GN=DOC2A PE=1 SV=5
4	F1R9U1	3.77e-158	454	422	0.585	0.571	F1R9U1_DANRE Double C2-like domain-containing protein alpha OS=Danio rerio OX=7955 GN=si:dkey-93n13.3 PE=4 SV=2
5	Q9Y2J0	1.05e-156	460	694	0.592	0.352	RP3A_HUMAN Rabphilin-3A OS=Homo sapiens OX=9606 GN=RPH3A PE=1 SV=1
6	Q7TNF0	7.05e-156	447	405	0.541	0.551	DOC2A_MOUSE Double C2-like domain-containing protein alpha OS=Mus musculus OX=10090 GN=Doc2a PE=2 SV=1
7	P70611	1.34e-155	447	403	0.539	0.551	DOC2A_RAT Double C2-like domain-containing protein alpha OS=Rattus norvegicus OX=10116 GN=Doc2a PE=1 SV=1
8	P47709	9.20e-154	452	684	0.563	0.339	RP3A_RAT Rabphilin-3A OS=Rattus norvegicus OX=10116 GN=Rph3a PE=1 SV=1
9	P47708	1.96e-153	451	681	0.517	0.313	RP3A_MOUSE Rabphilin-3A OS=Mus musculus OX=10090 GN=Rph3a PE=1 SV=2
10	Q768S5	5.08e-153	450	681	0.517	0.313	Q768S5_MOUSE Rabphilin OS=Mus musculus OX=10090 GN=Rph3a PE=2 SV=1
11	Q9ESN1	1.04e-118	352	387	0.498	0.530	DOC2G_MOUSE Double C2-like domain-containing protein gamma OS=Mus musculus OX=10090 GN=Doc2g PE=2 SV=1
12	H3BTI1	6.70e-87	265	218	0.337	0.638	H3BTI1_HUMAN Double C2 domain alpha (Fragment) OS=Homo sapiens OX=9606 GN=DOC2A PE=1 SV=5
13	P41885	6.24e-81	271	1106	0.306	0.114	RBF1_CAEEL Rabphilin-1 OS=Caenorhabditis elegans OX=6239 GN=rbf-1 PE=2 SV=2
14	H3BSH4	1.15e-79	246	203	0.318	0.645	H3BSH4_HUMAN Double C2 domain alpha (Fragment) OS=Homo sapiens OX=9606 GN=DOC2A PE=1 SV=7
15	Q6AWM2	1.48e-65	216	401	0.282	0.289	Q6AWM2_DROME RE32027p OS=Drosophila melanogaster OX=7227 GN=Rph PE=2 SV=1
16	Q9W2R9	1.30e-63	217	638	0.282	0.182	Q9W2R9_DROME Rabphilin, isoform A OS=Drosophila melanogaster OX=7227 GN=Rph PE=4 SV=2
17	O43581	1.50e-49	174	403	0.243	0.248	SYT7_HUMAN Synaptotagmin-7 OS=Homo sapiens OX=9606 GN=SYT7 PE=1 SV=3
18	D4P8S0	4.43e-49	175	488	0.250	0.211	D4P8S0_DANRE Synaptotagmin VIIb OS=Danio rerio OX=7955 GN=syt7 PE=2 SV=1
19	P46096	3.23e-48	171	421	0.267	0.261	SYT1_MOUSE Synaptotagmin-1 OS=Mus musculus OX=10090 GN=Syt1 PE=1 SV=1
20	P21707	3.41e-48	171	421	0.267	0.261	SYT1_RAT Synaptotagmin-1 OS=Rattus norvegicus OX=10116 GN=Syt1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	4.7e-48	173.1	C2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000482950

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000367756	0.889	Protein unc-13 homolog B
2	9606.ENSP00000317714	0.766	Syntaxin-4
3	9606.ENSP00000429562	0.715	Protein unc-13 homolog A
4	9606.ENSP00000362399	0.693	Syntaxin-binding protein 1
5	9606.ENSP00000359025	0.622	Syntaxin-binding protein 3
6	9606.ENSP00000477455	0.597	Glutamate receptor ionotropic, NMDA 2B
7	9606.ENSP00000249647	0.593	Synaptosomal-associated protein 23
8	9606.ENSP00000379818	0.577	Glutamate receptor ionotropic, NMDA 2A
9	9606.ENSP00000379601	0.571	Ras-related protein Rab-27A
10	9606.ENSP00000295101	0.563	G protein-activated inward rectifier potassium channel 1
11	9606.ENSP00000282878	0.555	Ras-related protein Rab-3C
12	9606.ENSP00000314214	0.550	Vesicle-associated membrane protein 2
13	9606.ENSP00000262094	0.545	Ras-related protein Rab-27B
14	9606.ENSP00000340125	0.506	Protein phosphatase 1 regulatory subunit 17

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005509	1.000	calcium ion binding
GO:0008289	0.995	lipid binding
GO:0005544	0.991	calcium-dependent phospholipid binding
GO:0000149	0.987	SNARE binding
GO:0019905	0.872	syntaxin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0006887	0.979	exocytosis
GO:0060627	0.978	regulation of vesicle-mediated transport
GO:0048518	0.976	positive regulation of biological process
GO:0045055	0.968	regulated exocytosis
GO:0099003	0.964	vesicle-mediated transport in synapse
GO:1903530	0.950	regulation of secretion by cell
GO:0016079	0.949	synaptic vesicle exocytosis
GO:0033043	0.948	regulation of organelle organization
GO:0031338	0.939	regulation of vesicle fusion
GO:0051050	0.937	positive regulation of transport
GO:0048522	0.929	positive regulation of cellular process
GO:0051130	0.885	positive regulation of cellular component organization
GO:0010638	0.881	positive regulation of organelle organization
GO:0051047	0.830	positive regulation of secretion
GO:1903532	0.821	positive regulation of secretion by cell
GO:0017157	0.596	regulation of exocytosis
GO:0017156	0.588	calcium-ion regulated exocytosis
GO:1903305	0.450	regulation of regulated secretory pathway
GO:0050896	0.325	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0005886	0.997	plasma membrane
GO:0012505	0.995	endomembrane system
GO:0032991	0.987	protein-containing complex
GO:0031090	0.971	organelle membrane
GO:0031410	0.945	cytoplasmic vesicle
GO:0012506	0.928	vesicle membrane
GO:0030659	0.924	cytoplasmic vesicle membrane
GO:0098588	0.919	bounding membrane of organelle
GO:0099503	0.917	secretory vesicle
GO:0005829	0.915	cytosol
GO:0045202	0.903	synapse
GO:0098793	0.849	presynapse
GO:0098796	0.807	membrane protein complex
GO:0030133	0.526	transport vesicle
GO:0008021	0.522	synaptic vesicle
GO:0030141	0.497	secretory granule
GO:0030658	0.433	transport vesicle membrane
GO:0099501	0.398	exocytic vesicle membrane
GO:0030672	0.383	synaptic vesicle membrane
GO:0031201	0.336	SNARE complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]