StarFunc result for job id Q14185

User Input

>input (1865 residues)
MTRWVPTKREEKYGVAFYNYDARGADELSLQIGDTVHILETYEGWYRGYTLRKKSKKGIF
PASYIHLKEAIVEGKGQHETVIPGDLPLIQEVTTTLREWSTIWRQLYVQDNREMFRSVRH
MIYDLIEWRSQILSGTLPQDELKELKKKVTAKIDYGNRILDLDLVVRDEDGNILDPELTS
TISLFRAHEIASKQVEERLQEEKSQKQNIDINRQAKFAATPSLALFVNLKNVVCKIGEDA
EVLMSLYDPVESKFISENYLVRWSSSGLPKDIDRLHNLRAVFTDLGSKDLKREKISFVCQ
IVRVGRMELRDNNTRKLTSGLRRPFGVAVMDVTDIINGKVDDEDKQHFIPFQPVAGENDF
LQTVINKVIAAKEVNHKGQGLWVTLKLLPGDIHQIRKEFPHLVDRTTAVARKTGFPEIIM
PGDVRNDIYVTLVQGDFDKGSKTTAKNVEVTVSVYDEDGKRLEHVIFPGAGDEAISEYKS
VIYYQVKQPRWFETVKVAIPIEDVNRSHLRFTFRHRSSQDSKDKSEKIFALAFVKLMRYD
GTTLRDGEHDLIVYKAEAKKLEDAATYLSLPSTKAELEEKGHSATGKSMQSLGSCTISKD
SFQISTLVCSTKLTQNVDLLGLLKWRSNTSLLQQNLRQLMKVDGGEVVKFLQDTLDALFN
IMMENSESETFDTLVFDALVFIIGLIADRKFQHFNPVLETYIKKHFSATLAYTKLTKVLK
NYVDGAEKPGVNEQLYKAMKALESIFKFIVRSRILFNQLYENKGEADFVESLLQLFRSIN
DMMSSMSDQTVRVKGAALKYLPTIVNDVKLVFDPKELSKMFTEFILNVPMGLLTIQKLYC
LIEIVHSDLFTQHDCREILLPMMTDQLKYHLERQEDLEACCQLLSHILEVLYRKDVGPTQ
RHVQIIMEKLLRTVNRTVISMGRDSELIGNFVACMTAILRQMEDYHYAHLIKTFGKMRTD
VVDFLMETFIMFKNLIGKNVYPFDWVIMNMVQNKVFLRAINQYADMLNKKFLDQANFELQ
LWNNYFHLAVAFLTQESLQLENFSSAKRAKILNKYGDMRRQIGFEIRDMWYNLGQHKIKF
IPEMVGPILEMTLIPETELRKATIPIFFDMMQCEFHSTRSFQMFENEIITKLDHEVEGGR
GDEQYKVLFDKILLEHCRKHKYLAKTGETFVKLVVRLMERLLDYRTIMHDENKENRMSCT
VNVLNFYKEIEREEMYIRYLYKLCDLHKECDNYTEAAYTLLLHAKLLKWSEDVCVAHLTQ
RDGYQATTQGQLKEQLYQEIIHYFDKGKMWEEAIALGKELAEQYENEMFDYEQLSELLKK
QAQFYENIVKVIRPKPDYFAVGYYGQGFPTFLRGKVFIYRGKEYERREDFEARLLTQFPN
AEKMKTTSPPGDDIKNSPGQYIQCFTVKPKLDLPPKFHRPVSEQIVSFYRVNEVQRFEYS
RPIRKGEKNPDNEFANMWIERTIYTTAYKLPGILRWFEVKSVFMVEISPLENAIETMQLT
NDKINSMVQQHLDDPSLPINPLSMLLNGIVDPAVMGGFANYEKAFFTDRYLQEHPEAHEK
IEKLKDLIAWQIPFLAEGIRIHGDKVTEALRPFHERMEACFKQLKEKVEKEYGVRIMPSS
LDDRRGSRPRSMVRSFTMPSSSRPLSVASVSSLSSDSTPSRPGSDGFALEPLLPKKMHSR
SQDKLDKDDLEKEKKDKKKEKRNSKHQEIFEKEFKPTDISLQQSEAVILSETISPLRPQR
PKSQVMNVIGSERRFSVSPSSPSSQQTPPPVTPRAKLSFSMQSSLELNGMTGADVADVPP
PLPLKGSVADYGNLMENQDLLGSPTPPPPPPHQRHLPPPLPSKTPPPPPPKTTRKQASVD
SGIVQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IUA6	0.703	0.712	0.000	1840	0.732	0.742	A0A0R4IUA6.pdb.gz
2	AFDB:P59764	0.780	0.738	0.000	1978	0.370	0.349	P59764.pdb.gz	DOCK4_MOUSE Dedicator of cytokinesis protein 4 OS=Mus musculus OX=10090 GN=Dock4 PE=1 SV=1
3	AFDB:Q14185	1.000	1.000	0.000	1865	1.000	1.000	Q14185.pdb.gz	DOCK1_HUMAN Dedicator of cytokinesis protein 1 OS=Homo sapiens OX=9606 GN=DOCK1 PE=1 SV=2
4	AFDB:Q8IZD9	0.761	0.703	0.000	2030	0.379	0.348	Q8IZD9.pdb.gz	DOCK3_HUMAN Dedicator of cytokinesis protein 3 OS=Homo sapiens OX=9606 GN=DOCK3 PE=1 SV=1
5	AFDB:Q92608	0.860	0.876	0.000	1830	0.587	0.598	Q92608.pdb.gz	DOCK2_HUMAN Dedicator of cytokinesis protein 2 OS=Homo sapiens OX=9606 GN=DOCK2 PE=1 SV=2
6	PDB:6tgbA	0.651	0.825	1.699E-77	1450	0.386	0.496	6tgbA.pdb.gz
7	AFDB:Q54DW1	0.234	0.250	2.172E-24	1736	0.100	0.107	Q54DW1.pdb.gz	Q54DW1_DICDI DOCK family protein OS=Dictyostelium discoideum OX=44689 GN=docC PE=3 SV=1
8	AFDB:Q6PR54	0.158	0.131	9.612E-9	2419	0.091	0.070	Q6PR54.pdb.gz	RIF1_MOUSE Telomere-associated protein RIF1 OS=Mus musculus OX=10090 GN=Rif1 PE=1 SV=2
9	AFDB:Q61037	0.111	0.113	7.806E-8	1814	0.090	0.092	Q61037.pdb.gz	TSC2_MOUSE Tuberin OS=Mus musculus OX=10090 GN=Tsc2 PE=1 SV=1
10	AFDB:Q6TRW4	0.090	0.103	3.720E-7	1447	0.093	0.120	Q6TRW4.pdb.gz	PDS5B_RAT Sister chromatid cohesion protein PDS5 homolog B OS=Rattus norvegicus OX=10116 GN=Pds5b PE=1 SV=2
11	AFDB:D3ZEY0	0.053	0.059	1.913E-6	1530	0.080	0.097	D3ZEY0.pdb.gz	CC141_RAT Coiled-coil domain-containing protein 141 OS=Rattus norvegicus OX=10116 GN=Ccdc141 PE=1 SV=2
12	PDB:6pyuA	0.077	0.134	1.989E-6	930	0.055	0.111	6pyuA.pdb.gz	Design of selective PI3K delta inhibitors using an iterative scaffold-hopping workflow.
13	PDB:4yknA	0.071	0.105	4.775E-6	1205	0.071	0.110	4yknA.pdb.gz	Discovery of a Potent Class of PI3K alpha Inhibitors with Unique Binding Mode via Encoded Library Technology (ELT).
14	PDB:4ajwB	0.065	0.139	1.237E-5	792	0.041	0.097	4ajwB.pdb.gz	Discovery and Optimization of New Benzimidazole- and Benzoxazole-Pyrimidone Selective Pi3Kbeta Inhibitors for the Treatment of Phosphatase and Tensin Homologue (Pten)-Deficient Cancers.
15	PDB:5itdA	0.069	0.122	2.030E-5	995	0.050	0.094	5itdA.pdb.gz	Discovery and Pharmacological Characterization of Novel Quinazoline-Based PI3K Delta-Selective Inhibitors.
16	PDB:6gy0A	0.069	0.148	3.086E-5	822	0.060	0.135	6gy0A.pdb.gz	A class of highly selective inhibitors bind to an active state of PI3K gamma.
17	PDB:7mezA	0.065	0.118	7.697E-5	989	0.053	0.099	7mezA.pdb.gz
18	PDB:1xi4A	0.059	0.064	1.126E-4	1630	0.061	0.069	1xi4A.pdb.gz
19	PDB:7tzcA	0.081	0.051	1.994E-4	4404	0.101	0.043	7tzcA.pdb.gz	A drug and ATP binding site in type 1 ryanodine receptor.
20	PDB:1qgkA	0.115	0.199	2.604E-4	876	0.042	0.089	1qgkA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A096LNH6	3864	1886	1.000	0.989	A0A096LNH6_HUMAN Dedicator of cytokinesis 1 OS=Homo sapiens OX=9606 GN=DOCK1 PE=1 SV=1
2	A0A0B4K7Q6	1310	2008	0.416	0.386	A0A0B4K7Q6_DROME Myoblast city, isoform B OS=Drosophila melanogaster OX=7227 GN=mbc PE=3 SV=1
3	A0A0B4KHD2	1098	2008	0.360	0.334	A0A0B4KHD2_DROME Sponge, isoform F OS=Drosophila melanogaster OX=7227 GN=spg PE=1 SV=1
4	A8E1V6	3172	1866	0.844	0.844	A8E1V6_DANRE Dedicator of cytokinesis 1 OS=Danio rerio OX=7955 GN=dock1 PE=1 SV=1
5	A8E1V7	2217	1867	0.605	0.605	A8E1V7_DANRE Dedicator of cytokinesis 5 OS=Danio rerio OX=7955 GN=dock5 PE=1 SV=1
6	B2RY04	2403	1868	0.642	0.641	DOCK5_MOUSE Dedicator of cytokinesis protein 5 OS=Mus musculus OX=10090 GN=Dock5 PE=1 SV=2
7	B7Z0R2	1105	2002	0.360	0.336	B7Z0R2_DROME Sponge, isoform D OS=Drosophila melanogaster OX=7227 GN=spg PE=1 SV=2
8	G5EEN3	639	1781	0.277	0.290	G5EEN3_CAEEL CED-5 OS=Caenorhabditis elegans OX=6239 GN=ced-5 PE=1 SV=1
9	H0Y599	1163	1999	0.353	0.329	H0Y599_HUMAN Dedicator of cytokinesis 4 (Fragment) OS=Homo sapiens OX=9606 GN=DOCK4 PE=1 SV=1
10	H0Y7N4	1333	1090	0.357	0.611	H0Y7N4_HUMAN Dedicator of cytokinesis 5 (Fragment) OS=Homo sapiens OX=9606 GN=DOCK5 PE=1 SV=1
11	Q14185	3876	1865	1.000	1.000	DOCK1_HUMAN Dedicator of cytokinesis protein 1 OS=Homo sapiens OX=9606 GN=DOCK1 PE=1 SV=2
12	Q149N5	1171	2011	0.356	0.330	Q149N5_HUMAN DOCK4 protein OS=Homo sapiens OX=9606 GN=DOCK4 PE=1 SV=1
13	Q8BUR4	3755	1865	0.965	0.965	DOCK1_MOUSE Dedicator of cytokinesis protein 1 OS=Mus musculus OX=10090 GN=Dock1 PE=1 SV=3
14	Q8C3J5	2194	1828	0.586	0.597	DOCK2_MOUSE Dedicator of cytokinesis protein 2 OS=Mus musculus OX=10090 GN=Dock2 PE=1 SV=3
15	Q8CIQ7	1211	2027	0.359	0.331	DOCK3_MOUSE Dedicator of cytokinesis protein 3 OS=Mus musculus OX=10090 GN=Dock3 PE=1 SV=1
16	Q8IZD9	1209	2030	0.360	0.331	DOCK3_HUMAN Dedicator of cytokinesis protein 3 OS=Homo sapiens OX=9606 GN=DOCK3 PE=1 SV=1
17	Q8MQW7	844	1292	0.265	0.383	Q8MQW7_DROME SD06708p (Fragment) OS=Drosophila melanogaster OX=7227 GN=mbc PE=2 SV=1
18	Q8MQY7	1179	1543	0.351	0.424	Q8MQY7_DROME RE54856p OS=Drosophila melanogaster OX=7227 GN=mbc PE=2 SV=1
19	Q8N1I0	1198	1966	0.356	0.338	DOCK4_HUMAN Dedicator of cytokinesis protein 4 OS=Homo sapiens OX=9606 GN=DOCK4 PE=1 SV=3
20	Q92608	2210	1830	0.585	0.596	DOCK2_HUMAN Dedicator of cytokinesis protein 2 OS=Homo sapiens OX=9606 GN=DOCK2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06920 DHR-2_Lobe_A	1.2e-17	76.1	DHR-2, Lobe A
2	PF20422 DHR-2_Lobe_B	4.7e-13	60.4	DHR-2, Lobe B
3	PF20421 DHR-2_Lobe_C	5.4e-17	72.9	DHR-2, Lobe C
4	PF14429 DOCK-C2	2.2e-62	221.8	C2 domain in Dock180 and Zizimin proteins
5	PF16172 DOCK_N	4.5e-102	353.5	DOCK N-terminus
6	PF00018 SH3_1	2.7e-06	38.2	SH3 domain
7	PF07653 SH3_2	0.004	28.3	Variant SH3 domain
8	PF14604 SH3_9	1.8e-05	35.9	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000280333

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000300574	0.999	Adapter molecule crk
2	9606.ENSP00000312185	0.999	Engulfment and cell motility protein 1
3	9606.ENSP00000391669	0.999	Breast cancer anti-estrogen resistance protein 1
4	9606.ENSP00000290246	0.998	Engulfment and cell motility protein 2
5	9606.ENSP00000339467	0.998	Rho-related GTP-binding protein RhoG
6	9606.ENSP00000377566	0.997	Engulfment and cell motility protein 3
7	9606.ENSP00000348461	0.995	Ras-related C3 botulinum toxin substrate 1
8	9606.ENSP00000346300	0.992	Crk-like protein
9	9606.ENSP00000314444	0.976	WD repeat-containing protein 35
10	9606.ENSP00000362680	0.975	Proto-oncogene tyrosine-protein kinase Src
11	9606.ENSP00000341189	0.972	Focal adhesion kinase 1
12	9606.ENSP00000451828	0.967	RAC-alpha serine/threonine-protein kinase
13	9606.ENSP00000389140	0.959	Netrin receptor DCC
14	9606.ENSP00000293662	0.948	General receptor for phosphoinositides 1-associated scaffold protein
15	9606.ENSP00000173229	0.942	Netrin-1
16	9606.ENSP00000249071	0.942	Ras-related C3 botulinum toxin substrate 2
17	9606.ENSP00000346671	0.938	Tyrosine-protein kinase Fyn
18	9606.ENSP00000298316	0.934	ADP-ribosylation factor 6
19	9606.ENSP00000382379	0.926	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A
20	9606.ENSP00000400175	0.924	Transforming protein RhoA

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005085	1.000	guanyl-nucleotide exchange factor activity
GO:0005096	0.751	GTPase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050789	0.983	regulation of biological process
GO:0140253	0.977	cell-cell fusion
GO:0048856	0.975	anatomical structure development
GO:0050794	0.971	regulation of cellular process
GO:0032501	0.969	multicellular organismal process
GO:0048869	0.964	cellular developmental process
GO:0050896	0.960	response to stimulus
GO:0006949	0.955	syncytium formation
GO:0000768	0.937	syncytium formation by plasma membrane fusion
GO:0030154	0.924	cell differentiation
GO:0048518	0.870	positive regulation of biological process
GO:0007520	0.865	myoblast fusion
GO:0071840	0.847	cellular component organization or biogenesis
GO:0051716	0.830	cellular response to stimulus
GO:0030335	0.824	positive regulation of cell migration
GO:0051179	0.812	localization
GO:0016043	0.799	cellular component organization
GO:0007165	0.793	signal transduction
GO:0030097	0.790	hemopoiesis
GO:0030155	0.782	regulation of cell adhesion
GO:0007275	0.782	multicellular organism development
GO:0051234	0.780	establishment of localization
GO:0016477	0.765	cell migration
GO:0035556	0.763	intracellular signal transduction
GO:0045785	0.719	positive regulation of cell adhesion
GO:0048731	0.695	system development
GO:0010810	0.680	regulation of cell-substrate adhesion
GO:0007399	0.671	nervous system development
GO:0061024	0.657	membrane organization
GO:0048583	0.619	regulation of response to stimulus
GO:0010811	0.575	positive regulation of cell-substrate adhesion
GO:0022008	0.561	neurogenesis
GO:0007264	0.559	small GTPase mediated signal transduction
GO:1900024	0.537	regulation of substrate adhesion-dependent cell spreading
GO:0016192	0.515	vesicle-mediated transport
GO:1900026	0.509	positive regulation of substrate adhesion-dependent cell spreading
GO:0010646	0.498	regulation of cell communication
GO:0023051	0.497	regulation of signaling
GO:0009966	0.482	regulation of signal transduction
GO:0051239	0.476	regulation of multicellular organismal process
GO:0007166	0.475	cell surface receptor signaling pathway
GO:1902531	0.441	regulation of intracellular signal transduction
GO:0048519	0.361	negative regulation of biological process
GO:0006996	0.328	organelle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043229	0.997	intracellular organelle
GO:0031974	0.995	membrane-enclosed lumen
GO:0070013	0.990	intracellular organelle lumen
GO:0016020	0.985	membrane
GO:0031981	0.979	nuclear lumen
GO:0005654	0.969	nucleoplasm
GO:0071944	0.957	cell periphery
GO:0005886	0.951	plasma membrane
GO:0043232	0.890	intracellular non-membrane-bounded organelle
GO:0032991	0.573	protein-containing complex
GO:0005856	0.490	cytoskeleton
GO:0016604	0.394	nuclear body
GO:0012505	0.382	endomembrane system
GO:0031982	0.307	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]