StarFunc result for job id Q14191

User Input

>input (1432 residues)
MSEKKLETTAQQRKCPEWMNVQNKRCAVEERKACVRKSVFEDDLPFLEFTGSIVYSYDAS
DCSFLSEDISMSLSDGDVVGFDMEWPPLYNRGKLGKVALIQLCVSESKCYLFHVSSMSVF
PQGLKMLLENKAVKKAGVGIEGDQWKLLRDFDIKLKNFVELTDVANKKLKCTETWSLNSL
VKHLLGKQLLKDKSIRCSNWSKFPLTEDQKLYAATDAYAGFIIYRNLEILDDTVQRFAIN
KEEEILLSDMNKQLTSISEEVMDLAKHLPHAFSKLENPRRVSILLKDISENLYSLRRMII
GSTNIETELRPSNNLNLLSFEDSTTGGVQQKQIREHEVLIHVEDETWDPTLDHLAKHDGE
DVLGNKVERKEDGFEDGVEDNKLKENMERACLMSLDITEHELQILEQQSQEEYLSDIAYK
STEHLSPNDNENDTSYVIESDEDLEMEMLKHLSPNDNENDTSYVIESDEDLEMEMLKSLE
NLNSGTVEPTHSKCLKMERNLGLPTKEEEEDDENEANEGEEDDDKDFLWPAPNEEQVTCL
KMYFGHSSFKPVQWKVIHSVLEERRDNVAVMATGYGKSLCFQYPPVYVGKIGLVISPLIS
LMEDQVLQLKMSNIPACFLGSAQSENVLTDIKLGKYRIVYVTPEYCSGNMGLLQQLEADI
GITLIAVDEAHCISEWGHDFRDSFRKLGSLKTALPMVPIVALTATASSSIREDIVRCLNL
RNPQITCTGFDRPNLYLEVRRKTGNILQDLQPFLVKTSSHWEFEGPTIIYCPSRKMTQQV
TGELRKLNLSCGTYHAGMSFSTRKDIHHRFVRDEIQCVIATIAFGMGINKADIRQVIHYG
APKDMESYYQEIGRAGRDGLQSSCHVLWAPADINLNRHLLTEIRNEKFRLYKLKMMAKME
KYLHSSRCRRQIILSHFEDKQVQKASLGIMGTEKCCDNCRSRLDHCYSMDDSEDTSWDFG
PQAFKLLSAVDILGEKFGIGLPILFLRGSNSQRLADQYRRHSLFGTGKDQTESWWKAFSR
QLITEGFLVEVSRYNKFMKICALTKKGRNWLHKANTESQSLILQANEELCPKKLLLPSSK
TVSSGTKEHCYNQVPVELSTEKKSNLEKLYSYKPCDKISSGSNISKKSIMVQSPEKAYSS
SQPVISAQEQETQIVLYGKLVEARQKHANKMDVPPAILATNKILVDMAKMRPTTVENVKR
IDGVSEGKAAMLAPLLEVIKHFCQTNSVQTDLFSSTKPQEEQKTSLVAKNKICTLSQSMA
ITYSLFQEKKMPLKSIAESRILPLMTIGMHLSQAVKAGCPLDLERAGLTPEVQKIIADVI
RNPPVNSDMSKISLIRMLVPENIDTYLIHMAIEILKHGPDSGLQPSCDVNKRRCFPGSEE
ICSSSKRSKEEVGINTETSSAERKRRLPVWFAKGSDTSKKLMDKTKRGGLFS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14191	1.000	1.000	0.000	1432	1.000	1.000	Q14191.pdb.gz	WRN_HUMAN Bifunctional 3'-5' exonuclease/ATP-dependent helicase WRN OS=Homo sapiens OX=9606 GN=WRN PE=1 SV=2
2	AFDB:Q9VGI8	0.347	0.335	6.305E-45	1487	0.198	0.190	Q9VGI8.pdb.gz	BLM_DROME RecQ-like DNA helicase Blm OS=Drosophila melanogaster OX=7227 GN=Blm PE=1 SV=1
3	AFDB:Q9FT73	0.318	0.634	8.728E-37	705	0.131	0.267	Q9FT73.pdb.gz	RECQ2_ARATH ATP-dependent DNA helicase Q-like 2 OS=Arabidopsis thaliana OX=3702 GN=RECQL2 PE=1 SV=1
4	AFDB:X1WCM8	0.262	0.397	2.341E-30	933	0.137	0.210	X1WCM8.pdb.gz	X1WCM8_DANRE ATP-dependent DNA helicase OS=Danio rerio OX=7955 GN=recql5 PE=3 SV=1
5	AFDB:Q9JIK5	0.204	0.330	1.180E-16	851	0.082	0.139	Q9JIK5.pdb.gz	DDX21_MOUSE Nucleolar RNA helicase 2 OS=Mus musculus OX=10090 GN=Ddx21 PE=1 SV=3
6	AFDB:Q4TVV3	0.193	0.264	8.161E-15	1018	0.099	0.139	Q4TVV3.pdb.gz	DDX46_DANRE Probable ATP-dependent RNA helicase DDX46 OS=Danio rerio OX=7955 GN=ddx46 PE=2 SV=1
7	AFDB:Q8TDD1	0.218	0.341	2.029E-13	881	0.087	0.142	Q8TDD1.pdb.gz	DDX54_HUMAN ATP-dependent RNA helicase DDX54 OS=Homo sapiens OX=9606 GN=DDX54 PE=1 SV=2
8	PDB:7pliA	0.205	0.586	3.493E-13	457	0.047	0.149	7pliA.pdb.gz	Structural basis for RNA-duplex unwinding by the DEAD-box helicase DbpA.
9	AFDB:Q07886	0.200	0.501	4.423E-13	521	0.059	0.161	Q07886.pdb.gz	DDX49_DROME Probable ATP-dependent RNA helicase Dbp45A OS=Drosophila melanogaster OX=7227 GN=Dbp45A PE=2 SV=2
10	AFDB:Q9Y6V7	0.208	0.565	1.729E-12	483	0.058	0.172	Q9Y6V7.pdb.gz	DDX49_HUMAN Probable ATP-dependent RNA helicase DDX49 OS=Homo sapiens OX=9606 GN=DDX49 PE=1 SV=1
11	AFDB:Q8GUG7	0.200	0.349	9.053E-12	781	0.070	0.128	Q8GUG7.pdb.gz	RH50_ARATH DEAD-box ATP-dependent RNA helicase 50 OS=Arabidopsis thaliana OX=3702 GN=RH50 PE=2 SV=2
12	PDB:3ex7C	0.207	0.678	1.108E-11	392	0.045	0.166	3ex7C.pdb.gz	Mechanism of ATP turnover inhibition in the EJC
13	PDB:7v2yF	0.174	0.505	4.548E-11	376	0.051	0.194	7v2yF.pdb.gz
14	PDB:7evoE	0.115	0.319	5.013E-11	455	0.057	0.180	7evoE.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
15	PDB:1fuuB	0.119	0.387	6.091E-11	380	0.052	0.195	1fuuB.pdb.gz
16	PDB:5zwny	0.110	0.343	6.714E-11	399	0.053	0.190	5zwny.pdb.gz	Structures of the fully assembledSaccharomyces cerevisiaespliceosome before activation
17	PDB:6qw65B	0.193	0.142	7.401E-11	2001	0.064	0.045	6qw65B.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
18	PDB:5dcaA	0.181	0.137	7.770E-11	1948	0.059	0.043	5dcaA.pdb.gz
19	PDB:7pq0B	0.119	0.385	3.189E-10	385	0.047	0.174	7pq0B.pdb.gz
20	PDB:7oqbp	0.114	0.320	3.348E-10	444	0.058	0.187	7oqbp.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6AI75	0.0	1615	1157	0.558	0.691	A0A8I6AI75_RAT DNA helicase OS=Rattus norvegicus OX=10116 GN=Wrn PE=1 SV=1
2	F1LTH9	0.0	2025	1400	0.693	0.709	F1LTH9_RAT DNA helicase OS=Rattus norvegicus OX=10116 GN=Wrn PE=1 SV=3
3	O09053	0.0	2047	1401	0.701	0.717	WRN_MOUSE Bifunctional 3'-5' exonuclease/ATP-dependent helicase WRN OS=Mus musculus OX=10090 GN=Wrn PE=1 SV=3
4	Q14191	0.0	2976	1432	1.000	1.000	WRN_HUMAN Bifunctional 3'-5' exonuclease/ATP-dependent helicase WRN OS=Homo sapiens OX=9606 GN=WRN PE=1 SV=2
5	Q19546	6.50e-121	406	1056	0.188	0.255	WRN_CAEEL ATP-dependent helicase wrn-1 OS=Caenorhabditis elegans OX=6239 GN=wrn-1 PE=3 SV=2
6	P15043	3.00e-97	328	609	0.127	0.299	RECQ_ECOLI ATP-dependent DNA helicase RecQ OS=Escherichia coli (strain K12) OX=83333 GN=recQ PE=1 SV=5
7	O34748	5.38e-84	290	591	0.137	0.332	RECQ_BACSU Probable ATP-dependent DNA helicase RecQ OS=Bacillus subtilis (strain 168) OX=224308 GN=recQ PE=3 SV=1
8	Q9FT72	4.68e-79	279	713	0.117	0.236	RQL3_ARATH ATP-dependent DNA helicase Q-like 3 OS=Arabidopsis thaliana OX=3702 GN=RECQL3 PE=1 SV=1
9	Q9FT70	2.89e-78	285	1150	0.137	0.170	RQL4B_ARATH ATP-dependent DNA helicase Q-like 4B OS=Arabidopsis thaliana OX=3702 GN=RECQL4B PE=2 SV=1
10	Q8L840	1.51e-76	280	1188	0.134	0.162	RQL4A_ARATH ATP-dependent DNA helicase Q-like 4A OS=Arabidopsis thaliana OX=3702 GN=RECQL4A PE=2 SV=1
11	Q9FT73	2.10e-76	271	705	0.106	0.216	RECQ2_ARATH ATP-dependent DNA helicase Q-like 2 OS=Arabidopsis thaliana OX=3702 GN=RECQL2 PE=1 SV=1
12	Q9FT74	1.02e-74	263	606	0.112	0.264	RQL1_ARATH ATP-dependent DNA helicase Q-like 1 OS=Arabidopsis thaliana OX=3702 GN=RECQL1 PE=2 SV=1
13	Q54DM3	1.02e-73	272	1259	0.129	0.147	Q54DM3_DICDI DNA helicase OS=Dictyostelium discoideum OX=44689 GN=blm PE=3 SV=1
14	P35187	8.15e-73	270	1447	0.149	0.148	SGS1_YEAST ATP-dependent helicase SGS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SGS1 PE=1 SV=1
15	P46063	9.71e-72	256	649	0.111	0.245	RECQ1_HUMAN ATP-dependent DNA helicase Q1 OS=Homo sapiens OX=9606 GN=RECQL PE=1 SV=3
16	Q6FLV3	8.52e-71	264	1371	0.122	0.127	Q6FLV3_CANGA Candida glabrata strain CBS138 chromosome L complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0L00407g PE=3 SV=1
17	Q09811	2.01e-70	262	1328	0.152	0.164	HUS2_SCHPO ATP-dependent DNA helicase hus2/rqh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rqh1 PE=1 SV=1
18	Q57TU4	1.75e-67	254	1548	0.106	0.098	Q57TU4_TRYB2 ATP-dependent DEAD/H DNA helicase recQ, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.30K1.580 PE=3 SV=1
19	Q5A5R4	1.18e-66	249	1189	0.108	0.130	Q5A5R4_CANAL DNA helicase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SGS1 PE=3 SV=1
20	Q55A06	3.77e-66	246	973	0.096	0.142	Q55A06_DICDI ATP-dependent DNA helicase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0272384 PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00270 DEAD	1.9e-12	58.8	DEAD/DEAH box helicase
2	PF01612 DNA_pol_A_exo1	9.3e-34	128.2	3'-5' exonuclease
3	PF00271 Helicase_C	7.9e-13	60.1	Helicase conserved C-terminal domain
4	PF00570 HRDC	2.6e-08	45.0	HRDC domain
5	PF14493 HTH_40	5.8e-11	54.0	Helix-turn-helix domain
6	PF06009 Laminin_II	1.7e+02	13.7	Laminin Domain II
7	PF16124 RecQ_Zn_bind	2.3e-06	39.5	RecQ zinc-binding
8	PF04851 ResIII	54	15.2	Type III restriction enzyme, res subunit
9	PF09382 RQC	8.5e-14	62.8	RQC domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000298139

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000269305	0.999	Cellular tumor antigen p53
2	9606.ENSP00000351284	0.999	DNA repair protein RAD52 homolog
3	9606.ENSP00000352257	0.999	X-ray repair cross-complementing protein 6
4	9606.ENSP00000305480	0.998	Flap endonuclease 1
5	9606.ENSP00000355506	0.998	Exonuclease 1
6	9606.ENSP00000351185	0.997	DNA replication ATP-dependent helicase/nuclease DNA2
7	9606.ENSP00000418960	0.997	Breast cancer type 1 susceptibility protein
8	9606.ENSP00000442336	0.997	DNA topoisomerase 3-alpha
9	9606.ENSP00000254719	0.996	Replication protein A 70 kDa DNA-binding subunit
10	9606.ENSP00000276603	0.996	Telomeric repeat-binding factor 1
11	9606.ENSP00000375978	0.996	X-ray repair cross-complementing protein 5
12	9606.ENSP00000307853	0.995	Crossover junction endonuclease MUS81
13	9606.ENSP00000310520	0.992	DNA repair endonuclease XPF
14	9606.ENSP00000355759	0.992	Poly [ADP-ribose] polymerase 1
15	9606.ENSP00000368458	0.991	Proliferating cell nuclear antigen
16	9606.ENSP00000372088	0.991	DNA repair protein RAD51 homolog 1
17	9606.ENSP00000343741	0.989	Serine/threonine-protein kinase ATR
18	9606.ENSP00000450607	0.989	Protein timeless homolog
19	9606.ENSP00000348056	0.987	SUMO-conjugating enzyme UBC9
20	9606.ENSP00000353332	0.981	Regulator of telomere elongation helicase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0008408	0.997	3'-5' exonuclease activity
GO:0003676	0.996	nucleic acid binding
GO:0043138	0.995	3'-5' DNA helicase activity
GO:0003684	0.985	damaged DNA binding
GO:0042803	0.979	protein homodimerization activity
GO:0042162	0.978	telomeric DNA binding
GO:0044877	0.975	protein-containing complex binding
GO:0046914	0.975	transition metal ion binding
GO:0030145	0.973	manganese ion binding
GO:0016887	0.973	ATP hydrolysis activity
GO:0000400	0.965	four-way junction DNA binding
GO:0000287	0.870	magnesium ion binding
GO:0009378	0.801	four-way junction helicase activity
GO:0000403	0.798	Y-form DNA binding
GO:0062037	0.797	D-loop DNA binding
GO:0000405	0.797	bubble DNA binding
GO:0032357	0.795	oxidized purine DNA binding
GO:0051880	0.783	G-quadruplex DNA binding
GO:0070336	0.782	flap-structured DNA binding
GO:0032405	0.780	MutLalpha complex binding
GO:0061821	0.571	telomeric D-loop binding
GO:1905773	0.570	8-hydroxy-2'-deoxyguanosine DNA binding
GO:0070337	0.569	3'-flap-structured DNA binding
GO:0061749	0.568	forked DNA-dependent helicase activity
GO:0061849	0.568	telomeric G-quadruplex DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006139	0.995	nucleobase-containing compound metabolic process
GO:0050789	0.984	regulation of biological process
GO:0043170	0.976	macromolecule metabolic process
GO:0050896	0.967	response to stimulus
GO:0006259	0.960	DNA metabolic process
GO:0071840	0.917	cellular component organization or biogenesis
GO:0016043	0.904	cellular component organization
GO:0050794	0.892	regulation of cellular process
GO:0051276	0.888	chromosome organization
GO:0006260	0.885	DNA replication
GO:0006974	0.857	cellular response to DNA damage stimulus
GO:0019222	0.832	regulation of metabolic process
GO:0006281	0.830	DNA repair
GO:0060255	0.819	regulation of macromolecule metabolic process
GO:0006261	0.815	DNA-templated DNA replication
GO:0080090	0.803	regulation of primary metabolic process
GO:0051171	0.794	regulation of nitrogen compound metabolic process
GO:0031323	0.789	regulation of cellular metabolic process
GO:0071103	0.755	DNA conformation change
GO:0032508	0.750	DNA duplex unwinding
GO:0019219	0.700	regulation of nucleobase-containing compound metabolic process
GO:0051052	0.640	regulation of DNA metabolic process
GO:0009628	0.601	response to abiotic stimulus
GO:0006302	0.562	double-strand break repair
GO:0048518	0.512	positive regulation of biological process
GO:0010604	0.439	positive regulation of macromolecule metabolic process
GO:0048522	0.383	positive regulation of cellular process
GO:0065009	0.348	regulation of molecular function
GO:0000723	0.342	telomere maintenance
GO:0045005	0.310	DNA-templated DNA replication maintenance of fidelity
GO:0051173	0.308	positive regulation of nitrogen compound metabolic process
GO:0009314	0.306	response to radiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005694	1.000	chromosome
GO:0005654	0.999	nucleoplasm
GO:0000781	0.994	chromosome, telomeric region
GO:0016604	0.917	nuclear body
GO:0032991	0.901	protein-containing complex
GO:0005730	0.722	nucleolus
GO:0005737	0.695	cytoplasm
GO:0005815	0.582	microtubule organizing center
GO:0005813	0.547	centrosome
GO:0016607	0.385	nuclear speck

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.-.-	0.997	Acting on ester bonds.
EC:5.6.2.4	0.995	DNA 3'-5' helicase.
RHEA:13065	0.973	ATP + H2O = ADP + H(+) + phosphate

[back to server]