StarFunc result for job id Q14192

User Input

>input (279 residues)
MTERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRH
WHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGS
SWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQP
WHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFE
ERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O35115	0.865	0.865	2.560E-58	279	0.914	0.914	O35115.pdb.gz	FHL2_RAT Four and a half LIM domains protein 2 OS=Rattus norvegicus OX=10116 GN=Fhl2 PE=1 SV=1
2	AFDB:Q9WTX7	0.561	0.552	5.837E-47	284	0.599	0.588	Q9WTX7.pdb.gz	FHL5_MOUSE Four and a half LIM domains protein 5 OS=Mus musculus OX=10090 GN=Fhl5 PE=1 SV=1
3	AFDB:Q5TD97	0.575	0.567	1.074E-45	284	0.599	0.588	Q5TD97.pdb.gz	FHL5_HUMAN Four and a half LIM domains protein 5 OS=Homo sapiens OX=9606 GN=FHL5 PE=1 SV=1
4	AFDB:Q9R059	0.826	0.800	7.732E-44	289	0.534	0.516	Q9R059.pdb.gz	FHL3_MOUSE Four and a half LIM domains protein 3 OS=Mus musculus OX=10090 GN=Fhl3 PE=1 SV=2
5	AFDB:M9MRX0	0.796	0.254	2.671E-43	989	0.552	0.156	M9MRX0.pdb.gz	M9MRX0_DROME Limpet, isoform J OS=Drosophila melanogaster OX=7227 GN=Lmpt PE=1 SV=1
6	AFDB:G5EDJ5	0.627	0.332	7.659E-43	619	0.548	0.247	G5EDJ5.pdb.gz	G5EDJ5_CAEEL LIM domain protein OS=Caenorhabditis elegans OX=6239 GN=lim-9 PE=1 SV=2
7	AFDB:M9PFX9	0.607	0.354	1.257E-42	559	0.552	0.275	M9PFX9.pdb.gz	M9PFX9_DROME Limpet, isoform P OS=Drosophila melanogaster OX=7227 GN=Lmpt PE=1 SV=2
8	AFDB:Q8MYZ5	0.639	0.549	3.186E-42	339	0.552	0.454	Q8MYZ5.pdb.gz	Q8MYZ5_DROME RE37250p OS=Drosophila melanogaster OX=7227 GN=Lmpt PE=2 SV=1
9	AFDB:A0A0K3AQM0	0.622	0.268	1.171E-41	793	0.548	0.193	A0A0K3AQM0.pdb.gz	A0A0K3AQM0_CAEEL Protein espinas OS=Caenorhabditis elegans OX=6239 GN=lim-9 PE=1 SV=1
10	AFDB:B0JZK9	0.720	0.718	6.239E-41	280	0.491	0.489	B0JZK9.pdb.gz
11	PDB:4kfzB	0.216	0.384	1.619E-8	148	0.111	0.209	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
12	PDB:1b8tA	0.220	0.314	1.707E-7	192	0.147	0.214	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
13	PDB:1imlA	0.186	0.572	4.385E-2	76	0.050	0.184	1imlA.pdb.gz	Structure of the cysteine-rich intestinal protein, CRIP.
14	PDB:5dkaA	0.103	0.279	1.111E-1	96	0.068	0.198	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
15	PDB:6oq5A	0.093	0.023	2.197E-1	2346	0.072	0.009	6oq5A.pdb.gz	Structure of the full-length Clostridium difficile toxin B.
16	PDB:3py7A	0.103	0.069	2.486E-1	500	0.090	0.050	3py7A.pdb.gz	Structural basis for hijacking of cellular LxxLL motifs by papillomavirus E6 oncoproteins.
17	PDB:4kblA	0.133	0.099	2.814E-1	395	0.097	0.068	4kblA.pdb.gz	Structure of HHARI, a RING-IBR-RING Ubiquitin Ligase: Autoinhibition of an Ariadne-Family E3 and Insights into Ligation Mechanism.
18	PDB:7n9qA	0.078	0.020	6.299E-1	2315	0.086	0.010	7n9qA.pdb.gz
19	PDB:7q3nU	0.145	0.140	7.130E-1	292	0.086	0.082	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
20	PDB:4r8pL	0.111	0.119	9.720E-1	254	0.036	0.039	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O35115	0.0	535	279	0.914	0.914	FHL2_RAT Four and a half LIM domains protein 2 OS=Rattus norvegicus OX=10116 GN=Fhl2 PE=1 SV=1
2	O70433	0.0	538	279	0.921	0.921	FHL2_MOUSE Four and a half LIM domains protein 2 OS=Mus musculus OX=10090 GN=Fhl2 PE=1 SV=1
3	Q14192	0.0	575	279	1.000	1.000	FHL2_HUMAN Four and a half LIM domains protein 2 OS=Homo sapiens OX=9606 GN=FHL2 PE=1 SV=3
4	Q9WTX7	3.10e-127	365	284	0.595	0.585	FHL5_MOUSE Four and a half LIM domains protein 5 OS=Mus musculus OX=10090 GN=Fhl5 PE=1 SV=1
5	Q5TD97	1.44e-125	360	284	0.591	0.581	FHL5_HUMAN Four and a half LIM domains protein 5 OS=Homo sapiens OX=9606 GN=FHL5 PE=1 SV=1
6	Q3S1I9	2.29e-120	347	290	0.548	0.528	Q3S1I9_CAEEL LIM zinc-binding domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=lim-9 PE=1 SV=2
7	O17833	7.69e-119	351	486	0.548	0.315	O17833_CAEEL LIM domain family OS=Caenorhabditis elegans OX=6239 GN=lim-9 PE=1 SV=2
8	Q13643	3.97e-118	342	280	0.534	0.532	FHL3_HUMAN Four and a half LIM domains protein 3 OS=Homo sapiens OX=9606 GN=FHL3 PE=1 SV=4
9	Q9VVB7	1.76e-117	342	339	0.552	0.454	Q9VVB7_DROME FI02842p OS=Drosophila melanogaster OX=7227 GN=Lmpt PE=1 SV=2
10	G5EDJ5	2.14e-117	351	619	0.548	0.247	G5EDJ5_CAEEL LIM domain protein OS=Caenorhabditis elegans OX=6239 GN=lim-9 PE=1 SV=2
11	Q8MYZ5	2.14e-117	342	339	0.552	0.454	Q8MYZ5_DROME RE37250p OS=Drosophila melanogaster OX=7227 GN=Lmpt PE=2 SV=1
12	G5EEA4	2.21e-117	350	564	0.548	0.271	G5EEA4_CAEEL LIM domain family OS=Caenorhabditis elegans OX=6239 GN=lim-9 PE=1 SV=2
13	Q7KUQ5	2.41e-117	340	286	0.552	0.538	Q7KUQ5_DROME Limpet, isoform F OS=Drosophila melanogaster OX=7227 GN=Lmpt PE=1 SV=1
14	G5EF39	1.09e-116	350	656	0.548	0.233	G5EF39_CAEEL LIM domain family OS=Caenorhabditis elegans OX=6239 GN=lim-9 PE=1 SV=1
15	A0A0K3AQM0	1.21e-115	352	793	0.548	0.193	A0A0K3AQM0_CAEEL Protein espinas OS=Caenorhabditis elegans OX=6239 GN=lim-9 PE=1 SV=1
16	Q8IQQ3	9.04e-115	343	558	0.552	0.276	Q8IQQ3_DROME Limpet, isoform D OS=Drosophila melanogaster OX=7227 GN=Lmpt PE=1 SV=1
17	M9PFX9	1.42e-114	342	559	0.552	0.275	M9PFX9_DROME Limpet, isoform P OS=Drosophila melanogaster OX=7227 GN=Lmpt PE=1 SV=2
18	Q9VVB5	1.73e-114	342	559	0.552	0.275	Q9VVB5_DROME LD46723p OS=Drosophila melanogaster OX=7227 GN=Lmpt PE=1 SV=2
19	M9MRX0	3.63e-112	347	989	0.548	0.155	M9MRX0_DROME Limpet, isoform J OS=Drosophila melanogaster OX=7227 GN=Lmpt PE=1 SV=1
20	Q9R059	1.07e-110	323	289	0.534	0.516	FHL3_MOUSE Four and a half LIM domains protein 3 OS=Mus musculus OX=10090 GN=Fhl3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06906 DUF1272	1.4e+02	14.0	Protein of unknown function (DUF1272)
2	PF00412 LIM	5.6e-44	159.5	LIM domain
3	PF13248 zf-ribbon_3	1.7e+02	13.0	zinc-ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000012986

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000021805	0.910	TNF receptor-associated factor 6, E3 ubiquitin protein ligase
2	61853.ENSNLEP00000006991	0.884	Catenin beta 1
3	61853.ENSNLEP00000014022	0.838	Caveolae associated protein 1
4	61853.ENSNLEP00000008931	0.833	Nicotinamide N-methyltransferase
5	61853.ENSNLEP00000015913	0.822	S100 calcium binding protein A10
6	61853.ENSNLEP00000010419	0.801	Receptor protein-tyrosine kinase
7	61853.ENSNLEP00000014631	0.775	Breast cancer type 1 susceptibility protein homolog
8	61853.ENSNLEP00000001356	0.759	Forkhead box O1
9	61853.ENSNLEP00000018707	0.735	Estrogen receptor
10	61853.ENSNLEP00000000665	0.733	Uncharacterized protein
11	61853.ENSNLEP00000011912	0.710	CREB binding protein
12	61853.ENSNLEP00000018748	0.707	E1A binding protein p300
13	61853.ENSNLEP00000001306	0.693	Growth factor receptor-bound protein 7
14	61853.ENSNLEP00000010243	0.692	Epithelial cell adhesion molecule
15	61853.ENSNLEP00000020373	0.668	Patched 1
16	61853.ENSNLEP00000011861	0.666	Cellular tumor antigen p53
17	61853.ENSNLEP00000014593	0.661	Sirtuin 1
18	61853.ENSNLEP00000018944	0.657	Mitogen-activated protein kinase 8
19	61853.ENSNLEP00000007481	0.645	Uncharacterized protein
20	61853.ENSNLEP00000007519	0.645	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:1902531	0.988	regulation of intracellular signal transduction
GO:0048519	0.987	negative regulation of biological process
GO:0048523	0.984	negative regulation of cellular process
GO:0050848	0.982	regulation of calcium-mediated signaling
GO:0106056	0.960	regulation of calcineurin-mediated signaling
GO:0070884	0.816	regulation of calcineurin-NFAT signaling cascade
GO:0048585	0.810	negative regulation of response to stimulus
GO:0009987	0.805	cellular process
GO:0009968	0.782	negative regulation of signal transduction
GO:0019222	0.579	regulation of metabolic process
GO:0031323	0.538	regulation of cellular metabolic process
GO:0032502	0.509	developmental process
GO:0048856	0.494	anatomical structure development
GO:0032501	0.492	multicellular organismal process
GO:0080090	0.487	regulation of primary metabolic process
GO:0051171	0.473	regulation of nitrogen compound metabolic process
GO:0060255	0.471	regulation of macromolecule metabolic process
GO:0010556	0.457	regulation of macromolecule biosynthetic process
GO:0031326	0.455	regulation of cellular biosynthetic process
GO:0051252	0.454	regulation of RNA metabolic process
GO:2001141	0.434	regulation of RNA biosynthetic process
GO:0010468	0.431	regulation of gene expression
GO:1903506	0.422	regulation of nucleic acid-templated transcription
GO:0050896	0.414	response to stimulus
GO:0006355	0.400	regulation of DNA-templated transcription
GO:0007275	0.367	multicellular organism development
GO:0048518	0.313	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	1.000	intracellular organelle
GO:0005737	0.998	cytoplasm
GO:0043232	0.994	intracellular non-membrane-bounded organelle
GO:0031981	0.993	nuclear lumen
GO:0099080	0.912	supramolecular complex
GO:0005654	0.910	nucleoplasm
GO:0099512	0.887	supramolecular fiber
GO:0043292	0.869	contractile fiber
GO:0030017	0.852	sarcomere
GO:0031674	0.805	I band
GO:0030018	0.804	Z disc
GO:0030054	0.436	cell junction
GO:0070161	0.427	anchoring junction
GO:0030055	0.418	cell-substrate junction
GO:0005925	0.390	focal adhesion
GO:0005829	0.323	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]