StarFunc result for job id Q14197

User Input

>input (206 residues)
MAATRCLRWGLSRAGVWLLPPPARCPRRALHKQKDGTEFKSIYSLDKLYPESQGSDTAWR
VPNGAKQADSDIPLDRLTISYCRSSGPGGQNVNKVNSKAEVRFHLATAEWIAEPVRQKIA
ITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDMITEASQTPKEPTKEDVKLHRIRI
ENMNRERLRQKRIHSAVKTSRRVDMD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14197	1.000	1.000	3.221E-40	206	1.000	1.000	Q14197.pdb.gz	ICT1_HUMAN Large ribosomal subunit protein mL62 OS=Homo sapiens OX=9606 GN=MRPL58 PE=1 SV=1
2	AFDB:Q3T116	0.642	0.642	2.055E-33	206	0.801	0.801	Q3T116.pdb.gz	ICT1_BOVIN Large ribosomal subunit protein mL62 OS=Bos taurus OX=9913 GN=MRPL58 PE=2 SV=1
3	AFDB:Q8R035	0.658	0.658	1.705E-32	206	0.796	0.796	Q8R035.pdb.gz	ICT1_MOUSE Large ribosomal subunit protein mL62 OS=Mus musculus OX=10090 GN=Mrpl58 PE=1 SV=1
4	PDB:6vlzp	0.551	0.736	9.267E-23	152	0.699	0.947	6vlzp.pdb.gz	Structures of the human mitochondrial ribosome bound to EF-G1 reveal distinct features of mitochondrial translation elongation.
5	PDB:3j9mp	0.503	0.808	3.367E-19	127	0.592	0.961	3j9mp.pdb.gz	Ribosome. The structure of the human mitochondrial ribosome.
6	AFDB:Q84JF2	0.504	0.449	5.820E-17	236	0.301	0.263	Q84JF2.pdb.gz	Q84JF2_ARATH Class I peptide chain release factor OS=Arabidopsis thaliana OX=3702 GN=At1g62850 PE=1 SV=1
7	AFDB:Q12322	0.450	0.458	5.052E-12	202	0.252	0.257	Q12322.pdb.gz	YO114_YEAST Putative uncharacterized protein YOL114C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YOL114C PE=4 SV=1
8	AFDB:Q9HDZ3	0.431	0.483	3.045E-10	182	0.214	0.242	Q9HDZ3.pdb.gz	MUG82_SCHPO Meiotically up-regulated gene 82 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug82 PE=1 SV=1
9	AFDB:P40711	0.411	0.592	2.364E-9	140	0.170	0.250	P40711.pdb.gz	ARFB_ECOLI Peptidyl-tRNA hydrolase ArfB OS=Escherichia coli (strain K12) OX=83333 GN=arfB PE=1 SV=2
10	AFDB:A0A384L363	0.361	0.183	8.493E-7	419	0.150	0.074	A0A384L363.pdb.gz	A0A384L363_ARATH Small ribosomal subunit protein mS35 mitochondrial conserved domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=At3g18240 PE=1 SV=1
11	AFDB:Q9Y811	0.289	0.359	2.474E-5	162	0.131	0.167	Q9Y811.pdb.gz	YONI_SCHPO Uncharacterized peptide chain release factor-like protein C1105.18c, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1105.18c PE=3 SV=2
12	PDB:7qi4A1	0.363	0.273	2.836E-5	279	0.068	0.050	7qi4A1.pdb.gz	Structure of mitoribosome reveals mechanism of mRNA binding, tRNA interactions with L1 stalk, roles of cofactors and rRNA modifications.
13	PDB:6xywBz	0.342	0.543	5.869E-5	123	0.107	0.179	6xywBz.pdb.gz	Cryo-EM structure of the RNA-rich plant mitochondrial ribosome.
14	AFDB:Q03976	0.366	0.243	7.612E-5	319	0.078	0.050	Q03976.pdb.gz	RT24_YEAST Small ribosomal subunit protein mS35 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RSM24 PE=1 SV=1
15	PDB:6hivCk	0.369	0.118	8.168E-5	703	0.121	0.036	6hivCk.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
16	PDB:7jss8	0.389	0.584	1.064E-4	132	0.155	0.242	7jss8.pdb.gz	ArfB can displace mRNA to rescue stalled ribosomes.
17	PDB:7pnt1	0.362	0.273	1.137E-4	278	0.078	0.058	7pnt1.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
18	PDB:6c4iv	0.275	0.161	1.690E-4	362	0.107	0.061	6c4iv.pdb.gz	Conformation of methylated GGQ in the Peptidyl Transferase Center during Translation Termination.
19	PDB:7nqhBL	0.282	0.234	3.064E-4	250	0.083	0.068	7nqhBL.pdb.gz	Structural basis of translation termination, rescue, and recycling in mammalian mitochondria.
20	PDB:6gxnv	0.294	0.180	2.227E-3	348	0.112	0.066	6gxnv.pdb.gz	Visualization of translation termination intermediates trapped by the Apidaecin 137 peptide during RF3-mediated recycling of RF1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14197	6.01e-155	429	206	1.000	1.000	ICT1_HUMAN Large ribosomal subunit protein mL62 OS=Homo sapiens OX=9606 GN=MRPL58 PE=1 SV=1
2	Q3T116	6.94e-124	350	206	0.801	0.801	ICT1_BOVIN Large ribosomal subunit protein mL62 OS=Bos taurus OX=9913 GN=MRPL58 PE=2 SV=1
3	Q8R035	8.10e-123	347	206	0.796	0.796	ICT1_MOUSE Large ribosomal subunit protein mL62 OS=Mus musculus OX=10090 GN=Mrpl58 PE=1 SV=1
4	Q84JF2	3.50e-29	110	236	0.262	0.229	Q84JF2_ARATH Class I peptide chain release factor OS=Arabidopsis thaliana OX=3702 GN=At1g62850 PE=1 SV=1
5	Q12322	1.25e-14	71.2	202	0.223	0.228	YO114_YEAST Putative uncharacterized protein YOL114C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YOL114C PE=4 SV=1
6	Q9HDZ3	4.48e-12	63.9	182	0.233	0.264	MUG82_SCHPO Meiotically up-regulated gene 82 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug82 PE=1 SV=1
7	P40711	1.98e-04	42.4	140	0.141	0.207	ARFB_ECOLI Peptidyl-tRNA hydrolase ArfB OS=Escherichia coli (strain K12) OX=83333 GN=arfB PE=1 SV=2
8	Q9LVY0	0.021	37.7	456	0.083	0.037	PRFB1_ARATH Peptide chain release factor PrfB1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PRFB1 PE=2 SV=1
9	Q9H799	0.61	33.5	3197	0.058	0.004	CPLN1_HUMAN Ciliogenesis and planar polarity effector 1 OS=Homo sapiens OX=9606 GN=CPLANE1 PE=1 SV=4
10	P9WHG1	0.62	33.1	371	0.068	0.038	RF2_MYCTU Peptide chain release factor 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=prfB PE=1 SV=1
11	F4JGR5	0.67	33.1	569	0.092	0.033	PFPB2_ARATH Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit beta 2 OS=Arabidopsis thaliana OX=3702 GN=PFP-BETA2 PE=3 SV=1
12	Q9STV0	0.70	33.1	1278	0.063	0.010	GWD2_ARATH Alpha-glucan water dikinase 2 OS=Arabidopsis thaliana OX=3702 GN=GWD2 PE=2 SV=3
13	Q9C9K3	1.2	32.3	617	0.083	0.028	PFPA2_ARATH Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit alpha 2 OS=Arabidopsis thaliana OX=3702 GN=PFP-ALPHA2 PE=2 SV=1
14	O51214	1.3	32.0	357	0.097	0.056	RF1_BORBU Peptide chain release factor 1 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=prfA PE=3 SV=1
15	A0A0C4DH01	1.4	32.0	672	0.160	0.049	A0A0C4DH01_HUMAN RNA polymerase III subunit E OS=Homo sapiens OX=9606 GN=POLR3E PE=1 SV=1
16	Q9NVU0	1.5	32.0	708	0.160	0.047	RPC5_HUMAN DNA-directed RNA polymerase III subunit RPC5 OS=Homo sapiens OX=9606 GN=POLR3E PE=1 SV=1
17	Q05863	2.3	30.8	155	0.053	0.071	YL281_YEAST Uncharacterized peptide chain release factor-like protein YLR281C, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YLR281C PE=1 SV=1
18	Q9VEZ5	3.5	30.8	751	0.097	0.027	IKKB_DROME Inhibitor of nuclear factor kappa-B kinase subunit beta OS=Drosophila melanogaster OX=7227 GN=IKKbeta PE=1 SV=2
19	Q8RX79	3.8	30.8	422	0.063	0.031	APG3_ARATH Peptide chain release factor APG3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=APG3 PE=2 SV=1
20	Q9C875	6.8	29.6	257	0.126	0.101	Q9C875_ARATH Class I peptide chain release factor OS=Arabidopsis thaliana OX=3702 GN=T16O9.18 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00472 RF-1	9.7e-16	69.1	RF-1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000301585

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000333837	0.999	39S ribosomal protein L12, mitochondrial
2	9606.ENSP00000377486	0.999	Mitochondrial ribosomal protein L19
3	9606.ENSP00000354580	0.998	Mitochondrial ribosomal protein L21
4	9606.ENSP00000356001	0.998	39S ribosomal protein L18, mitochondrial
5	9606.ENSP00000225969	0.997	Mitochondrial ribosomal protein L27
6	9606.ENSP00000264995	0.997	Mitochondrial ribosomal protein L3
7	9606.ENSP00000305682	0.997	Mitochondrial ribosomal protein L39
8	9606.ENSP00000306548	0.997	Mitochondrial ribosomal protein L13
9	9606.ENSP00000341082	0.997	Mitochondrial ribosomal protein L20
10	9606.ENSP00000360498	0.997	39S ribosomal protein L41, mitochondrial
11	9606.ENSP00000373404	0.997	Mitochondrial ribosomal protein L2
12	9606.ENSP00000417602	0.997	Belongs to the universal ribosomal protein uL29 family.
13	9606.ENSP00000253099	0.996	Mitochondrial ribosomal protein L4
14	9606.ENSP00000333401	0.996	Mitochondrial ribosomal protein L40
15	9606.ENSP00000354086	0.996	Mitochondrial ribosomal protein L37
16	9606.ENSP00000199706	0.995	Mitochondrial ribosomal protein L28
17	9606.ENSP00000288937	0.995	Mitochondrial ribosomal protein L17
18	9606.ENSP00000290208	0.995	Mitochondrial ribosomal protein L10
19	9606.ENSP00000308897	0.995	Mitochondrial ribosomal protein L11
20	9606.ENSP00000357823	0.995	Mitochondrial ribosomal protein L9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140101	1.000	catalytic activity, acting on a tRNA
GO:0052689	1.000	carboxylic ester hydrolase activity
GO:0003747	1.000	translation release factor activity
GO:0004045	0.982	aminoacyl-tRNA hydrolase activity
GO:0016150	0.947	translation release factor activity, codon nonspecific
GO:0005515	0.812	protein binding
GO:0003723	0.656	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044238	0.998	primary metabolic process
GO:0044237	0.998	cellular metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:0043170	0.992	macromolecule metabolic process
GO:0034641	0.985	cellular nitrogen compound metabolic process
GO:0071840	0.978	cellular component organization or biogenesis
GO:0010467	0.973	gene expression
GO:0044260	0.973	cellular macromolecule metabolic process
GO:0019538	0.973	protein metabolic process
GO:0044271	0.973	cellular nitrogen compound biosynthetic process
GO:0043933	0.971	protein-containing complex organization
GO:0009059	0.971	macromolecule biosynthetic process
GO:1901566	0.971	organonitrogen compound biosynthetic process
GO:0043603	0.969	amide metabolic process
GO:0140053	0.964	mitochondrial gene expression
GO:0006412	0.962	translation
GO:0022411	0.948	cellular component disassembly
GO:0032543	0.948	mitochondrial translation
GO:0032984	0.937	protein-containing complex disassembly
GO:0006415	0.455	translational termination

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0031090	0.996	organelle membrane
GO:0031975	0.995	envelope
GO:0070013	0.992	intracellular organelle lumen
GO:0019866	0.991	organelle inner membrane
GO:0005740	0.978	mitochondrial envelope
GO:0032991	0.971	protein-containing complex
GO:0043232	0.965	intracellular non-membrane-bounded organelle
GO:0005743	0.962	mitochondrial inner membrane
GO:0005840	0.895	ribosome
GO:0005759	0.893	mitochondrial matrix
GO:0044391	0.879	ribosomal subunit
GO:0000313	0.874	organellar ribosome
GO:0005761	0.838	mitochondrial ribosome
GO:0015934	0.837	large ribosomal subunit
GO:0031981	0.835	nuclear lumen
GO:0005654	0.832	nucleoplasm
GO:0098798	0.781	mitochondrial protein-containing complex
GO:0000315	0.717	organellar large ribosomal subunit
GO:0005762	0.632	mitochondrial large ribosomal subunit
GO:0071944	0.364	cell periphery
GO:0005886	0.318	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.1.-	1.000	Carboxylic ester hydrolases.
RHEA:54448	0.982	an N-acyl-L-alpha-aminoacyl-tRNA + H2O = a tRNA + an N-acyl-L-amino acid + H(+)
EC:3.1.1.29	0.982	peptidyl-tRNA hydrolase.

[back to server]