StarFunc result for job id Q14202

User Input

>input (1370 residues)
MDPSDFPSPFDPLTLPEKPLAGDLPVDMEFGEDLLESQTAPTRGWAPPGPSPSSGALDLL
DTPAGLEKDPGVLDGATELLGLGGLLYKAPSPPEVDHGPEGTLAWDAGDQTLEPGPGGQT
PEVVPPDPGAGANSCSPEGLLEPLAPDSPITLQSPHIEEEETTSIATARRGSPGQEEELP
QGQPQSPNAPPSPSVGETLGDGINSSQTKPGGSSPPAHPSLPGDGLTAKASEKPPERKRS
ERVRRAEPPKPEVVDSTESIPVSDEDSDAMVDDPNDEDFVPFRPRRSPRMSLRSSVSQRA
GRSAVGTKMTCAHCRTPLQKGQTAYQRKGLPQLFCSSSCLTTFSKKPSGKKTCTFCKKEI
WNTKDSVVAQTGSGGSFHEFCTSVCLSLYEAQQQRPIPQSGDPADATRCSICQKTGEVLH
EVSNGSVVHRLCSDSCFSKFRANKGLKTNCCDQCGAYIYTKTGSPGPELLFHEGQQKRFC
NTTCLGAYKKKNTRVYPCVWCKTLCKNFEMLSHVDRNGKTSLFCSLCCTTSYKVKQAGLT
GPPRPCSFCRRSLSDPCYYNKVDRTVYQFCSPSCWTKFQRTSPEGGIHLSCHYCHSLFSG
KPEVLDWQDQVFQFCCRDCCEDFKRLRGVVSQCEHCRQEKLLHEKLRFSGVEKSFCSEGC
VLLYKQDFTKKLGLCCITCTYCSQTCQRGVTEQLDGSTWDFCSEDCKSKYLLWYCKAARC
HACKRQGKLLETIHWRGQIRHFCNQQCLLRFYSQQNQPNLDTQSGPESLLNSQSPESKPQ
TPSQTKVENSNTVRTPEENGNLGKIPVKTRSAPTAPTPPPPPPPATPRKNKAAMCKPLMQ
NRGVSCKVEMKSKGSQTEEWKPQVIVLPIPVPIFVPVPMHLYCQKVPVPFSMPIPVPVPM
FLPTTLESTDKIVETIEELKVKIPSNPLEADILAMAEMIAEAEELDKASSDLCDLVSNQS
AEGLLEDCDLFGPARDDVLAMAVKMANVLDEPGQDLEADFPKNPLDINPSVDFLFDCGLV
GPEDVSTEQDLPRTMRKGQKRLVLSESCSRDSMSSQPSCTGLNYSYGVNAWKCWVQSKYA
NGETSKGDELRFGPKPMRIKEDILACSAAELNYGLAQFVREITRPNGERYEPDSIYYLCL
GIQQYLLENNRMVNIFTDLYYLTFVQELNKSLSTWQPTLLPNNTVFSRVEEEHLWECKQL
GVYSPFVLLNTLMFFNTKFFGLQTAEEHMQLSFTNVVRQSRKCTTPRGTTKVVSIRYYAP
VRQRKGRDTGPGKRKREDEAPILEQRENRMNPLRCPVKFYEFYLSKCPESLRTRNDVFYL
QPERSCIAESPLWYSVIPMDRSMLESMLNRILAVREIYEELGRPGEEDLD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14202	1.000	1.000	0.000	1370	1.000	1.000	Q14202.pdb.gz	ZMYM3_HUMAN Zinc finger MYM-type protein 3 OS=Homo sapiens OX=9606 GN=ZMYM3 PE=1 SV=2
2	AFDB:Q9ULJ3	0.045	0.048	1.195E-6	1066	0.113	0.145	Q9ULJ3.pdb.gz	ZBT21_HUMAN Zinc finger and BTB domain-containing protein 21 OS=Homo sapiens OX=9606 GN=ZBTB21 PE=1 SV=2
3	AFDB:A0A024RC04	0.045	0.062	6.012E-6	805	0.080	0.135	A0A024RC04.pdb.gz
4	AFDB:P20662	0.048	0.074	7.457E-6	777	0.068	0.120	P20662.pdb.gz	ZFY2_MOUSE Zinc finger Y-chromosomal protein 2 OS=Mus musculus OX=10090 GN=Zfy2 PE=2 SV=2
5	AFDB:A7Y7X5	0.040	0.061	1.349E-5	761	0.076	0.137	A7Y7X5.pdb.gz	ZN711_DANRE Zinc finger protein 711 OS=Danio rerio OX=7955 GN=znf711 PE=1 SV=1
6	AFDB:Q9QXD8	0.055	0.091	2.439E-5	668	0.080	0.163	Q9QXD8.pdb.gz	LIMD1_MOUSE LIM domain-containing protein 1 OS=Mus musculus OX=10090 GN=Limd1 PE=1 SV=2
7	AFDB:A0A1D8PRQ6	0.048	0.046	3.960E-5	1468	0.115	0.108	A0A1D8PRQ6.pdb.gz	A0A1D8PRQ6_CANAL Lrg1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=LRG1 PE=4 SV=1
8	AFDB:D3Z8E6	0.035	0.031	1.163E-4	1604	0.127	0.108	D3Z8E6.pdb.gz	CAMP1_RAT Calmodulin-regulated spectrin-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Camsap1 PE=1 SV=2
9	AFDB:P78332	0.040	0.046	1.607E-4	1123	0.116	0.142	P78332.pdb.gz	RBM6_HUMAN RNA-binding protein 6 OS=Homo sapiens OX=9606 GN=RBM6 PE=1 SV=5
10	AFDB:Q96T25	0.047	0.081	2.905E-4	663	0.084	0.173	Q96T25.pdb.gz	ZIC5_HUMAN Zinc finger protein ZIC 5 OS=Homo sapiens OX=9606 GN=ZIC5 PE=1 SV=2
11	PDB:4kfzB	0.044	0.191	5.421E-4	148	0.019	0.176	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
12	PDB:1b8tA	0.036	0.137	2.765E-2	192	0.026	0.188	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
13	PDB:7ls2Q2	0.030	0.358	1.726E-1	110	0.005	0.064	7ls2Q2.pdb.gz	Functionally distinct roles for eEF2K in the control of ribosome availability and p-body abundance.
14	PDB:3b4vD	0.032	0.133	3.293E-1	213	0.019	0.122	3b4vD.pdb.gz
15	PDB:1imlA	0.029	0.270	8.228E-1	76	0.012	0.224	1imlA.pdb.gz	Structure of the cysteine-rich intestinal protein, CRIP.
16	PDB:7av6A	0.034	0.238	9.164E-1	99	0.011	0.152	7av6A.pdb.gz
17	PDB:7mq8LT	0.031	0.044	1.657	869	0.025	0.039	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:6sjvA	0.040	0.086	1.749	529	0.018	0.045	6sjvA.pdb.gz	Cellular target recognition by HPV18 and HPV49 oncoproteins
19	PDB:7ajlAAA	0.043	0.144	1.749	290	0.010	0.048	7ajlAAA.pdb.gz
20	PDB:7pksa	0.058	0.064	1.749	1227	0.012	0.014	7pksa.pdb.gz	Structural basis of Integrator-mediated transcription regulation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NHB5	0.0	2820	1372	1.000	0.999	A6NHB5_HUMAN Zinc finger MYM-type containing 3 OS=Homo sapiens OX=9606 GN=ZMYM3 PE=1 SV=1
2	A6NHN7	0.0	2410	1280	0.858	0.919	A6NHN7_HUMAN Zinc finger MYM-type containing 3 OS=Homo sapiens OX=9606 GN=ZMYM3 PE=1 SV=1
3	A6NL54	0.0	990	497	0.358	0.988	A6NL54_HUMAN Zinc finger MYM-type containing 3 OS=Homo sapiens OX=9606 GN=ZMYM3 PE=1 SV=1
4	Q14202	0.0	2825	1370	1.000	1.000	ZMYM3_HUMAN Zinc finger MYM-type protein 3 OS=Homo sapiens OX=9606 GN=ZMYM3 PE=1 SV=2
5	Q5VZL5	0.0	792	1548	0.351	0.311	ZMYM4_HUMAN Zinc finger MYM-type protein 4 OS=Homo sapiens OX=9606 GN=ZMYM4 PE=1 SV=1
6	Q9CU65	0.0	885	1376	0.366	0.365	ZMYM2_MOUSE Zinc finger MYM-type protein 2 OS=Mus musculus OX=10090 GN=Zmym2 PE=1 SV=3
7	Q9JLM4	0.0	2628	1370	0.953	0.953	ZMYM3_MOUSE Zinc finger MYM-type protein 3 OS=Mus musculus OX=10090 GN=Zmym3 PE=1 SV=1
8	Q9UBW7	0.0	880	1377	0.364	0.362	ZMYM2_HUMAN Zinc finger MYM-type protein 2 OS=Homo sapiens OX=9606 GN=ZMYM2 PE=1 SV=1
9	A6NC58	9.99e-170	511	349	0.189	0.742	A6NC58_HUMAN Zinc finger MYM-type containing 3 OS=Homo sapiens OX=9606 GN=ZMYM3 PE=1 SV=1
10	A0A0B4K7W6	1.58e-107	358	712	0.170	0.327	A0A0B4K7W6_DROME Without children, isoform C OS=Drosophila melanogaster OX=7227 GN=woc PE=1 SV=1
11	Q95TK6	7.84e-104	357	1043	0.170	0.223	Q95TK6_DROME LD44304p OS=Drosophila melanogaster OX=7227 GN=woc PE=2 SV=1
12	A0A0B4KHZ0	4.38e-102	361	1702	0.170	0.137	A0A0B4KHZ0_DROME Without children, isoform E OS=Drosophila melanogaster OX=7227 GN=woc PE=1 SV=1
13	A8JRE3	5.29e-102	361	1703	0.170	0.137	A8JRE3_DROME Without children, isoform B OS=Drosophila melanogaster OX=7227 GN=woc PE=1 SV=1
14	Q6AWL3	6.64e-102	360	1688	0.170	0.138	Q6AWL3_DROME RE05635p OS=Drosophila melanogaster OX=7227 GN=woc PE=2 SV=1
15	A0A0B4KI43	7.38e-102	360	1687	0.170	0.138	A0A0B4KI43_DROME Without children, isoform D OS=Drosophila melanogaster OX=7227 GN=woc PE=1 SV=1
16	Q9VB55	7.91e-102	360	1688	0.170	0.138	Q9VB55_DROME Without children, isoform A OS=Drosophila melanogaster OX=7227 GN=woc PE=1 SV=2
17	Q9N9Z6	2.29e-101	359	1688	0.169	0.137	Q9N9Z6_DROME WOC protein OS=Drosophila melanogaster OX=7227 GN=woc PE=4 SV=1
18	O95789	3.19e-83	301	1325	0.150	0.155	ZMYM6_HUMAN Zinc finger MYM-type protein 6 OS=Homo sapiens OX=9606 GN=ZMYM6 PE=1 SV=2
19	Q3UA37	2.81e-74	266	777	0.101	0.178	QRIC1_MOUSE Transcriptional regulator QRICH1 OS=Mus musculus OX=10090 GN=Qrich1 PE=1 SV=1
20	A1L3Z9	3.95e-74	266	776	0.101	0.178	A1L3Z9_HUMAN Glutamine-rich 1 OS=Homo sapiens OX=9606 GN=QRICH1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08394 Arc_trans_TRASH	17	17.2	Archaeal TRASH domain
2	PF12012 DUF3504	3e-62	220.9	Domain of unknown function (DUF3504)
3	PF05573 NosL	16	17.3	NosL
4	PF04945 YHS	64	15.0	YHS domain
5	PF06467 zf-FCS	7.6e-66	229.1	MYM-type Zinc finger with FCS sequence motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000322845

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000383042	0.904	Lysine-specific histone demethylase 1A
2	9606.ENSP00000430432	0.879	Histone deacetylase 2
3	9606.ENSP00000362649	0.848	Histone deacetylase 1
4	9606.ENSP00000460070	0.842	General transcription factor II-I
5	9606.ENSP00000349508	0.806	Chromodomain-helicase-DNA-binding protein 4
6	9606.ENSP00000262241	0.735	REST corepressor 1
7	9606.ENSP00000317743	0.734	Putative nuclease HARBI1
8	9606.ENSP00000428585	0.733	Small integral membrane protein 12
9	9606.ENSP00000271715	0.732	Pogo transposable element with ZNF domain
10	9606.ENSP00000245838	0.694	THO complex subunit 2
11	9606.ENSP00000431404	0.692	PiggyBac transposable element-derived protein 5
12	9606.ENSP00000369131	0.689	Paired amphipathic helix protein Sin3b
13	9606.ENSP00000319974	0.687	HMG box transcription factor BBX
14	9606.ENSP00000384367	0.680	BTB/POZ domain-containing protein KCTD1
15	9606.ENSP00000440440	0.642	Activating transcription factor 7-interacting protein 1
16	9606.ENSP00000234170	0.641	CCAAT/enhancer-binding protein zeta
17	9606.ENSP00000401191	0.637	Probable 18S rRNA (guanine-N(7))-methyltransferase
18	9606.ENSP00000339532	0.632	THUMP domain-containing protein 3
19	9606.ENSP00000418960	0.625	Breast cancer type 1 susceptibility protein
20	9606.ENSP00000378402	0.618	Paired amphipathic helix protein Sin3a

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	0.992	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050789	0.988	regulation of biological process
GO:0071840	0.910	cellular component organization or biogenesis
GO:0016043	0.895	cellular component organization
GO:0050793	0.701	regulation of developmental process
GO:0050794	0.646	regulation of cellular process
GO:0006996	0.618	organelle organization
GO:0019222	0.577	regulation of metabolic process
GO:0060255	0.563	regulation of macromolecule metabolic process
GO:0022604	0.563	regulation of cell morphogenesis
GO:0010468	0.466	regulation of gene expression
GO:0080090	0.433	regulation of primary metabolic process
GO:0051171	0.433	regulation of nitrogen compound metabolic process
GO:0007010	0.433	cytoskeleton organization
GO:0031323	0.406	regulation of cellular metabolic process
GO:0019219	0.361	regulation of nucleobase-containing compound metabolic process
GO:0071704	0.336	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.366	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]