StarFunc result for job id Q14204

User Input

>input (1400 residues)
MSEPGGGGGEDGSAGLEVSAVQNVADVSVLQKHLRKLVPLLLEDGGEAPAALEAALEEKS
ALEQMRKFLSDPQVHTVLVERSTLKEDVGDEGEEEKEFISYNINIDIHYGVKSNSLAFIK
RTPVIDADKPVSSQLRVLTLSEDSPYETLHSFISNAVAPFFKSYIRESGKADRDGDKMAP
SVEKKIAELEMGLLHLQQNIEIPEISLPIHPMITNVAKQCYERGEKPKVTDFGDKVEDPT
FLNQLQSGVNRWIREIQKVTKLDRDPASGTALQEISFWLNLERALYRIQEKRESPEVLLT
LDILKHGKRFHATVSFDTDTGLKQALETVNDYNPLMKDFPLNDLLSATELDKIRQALVAI
FTHLRKIRNTKYPIQRALRLVEAISRDLSSQLLKVLGTRKLMHVAYEEFEKVMVACFEVF
QTWDDEYEKLQVLLRDIVKRKREENLKMVWRINPAHRKLQARLDQMRKFRRQHEQLRAVI
VRVLRPQVTAVAQQNQGEVPEPQDMKVAEVLFDAADANAIEEVNLAYENVKEVDGLDVSK
EGTEAWEAAMKRYDERIDRVETRITARLRDQLGTAKNANEMFRIFSRFNALFVRPHIRGA
IREYQTQLIQRVKDDIESLHDKFKVQYPQSQACKMSHVRDLPPVSGSIIWAKQIDRQLTA
YMKRVEDVLGKGWENHVEGQKLKQDGDSFRMKLNTQEIFDDWARKVQQRNLGVSGRIFTI
ESTRVRGRTGNVLKLKVNFLPEIITLSKEVRNLKWLGFRVPLAIVNKAHQANQLYPFAIS
LIESVRTYERTCEKVEERNTISLLVAGLKKEVQALIAEGIALVWESYKLDPYVQRLAETV
FNFQEKVDDLLIIEEKIDLEVRSLETCMYDHKTFSEILNRVQKAVDDLNLHSYSNLPIWV
NKLDMEIERILGVRLQAGLRAWTQVLLGQAEDKAEVDMDTDAPQVSHKPGGEPKIKNVVH
ELRITNQVIYLNPPIEECRYKLYQEMFAWKMVVLSLPRIQSQRYQVGVHYELTEEEKFYR
NALTRMPDGPVALEESYSAVMGIVSEVEQYVKVWLQYQCLWDMQAENIYNRLGEDLNKWQ
ALLVQIRKARGTFDNAETKKEFGPVVIDYGKVQSKVNLKYDSWHKEVLSKFGQMLGSNMT
EFHSQISKSRQELEQHSVDTASTSDAVTFITYVQSLKRKIKQFEKQVELYRNGQRLLEKQ
RFQFPPSWLYIDNIEGEWGAFNDIMRRKDSAIQQQVANLQMKIVQEDRAVESRTTDLLTD
WEKTKPVTGNLRPEEALQALTIYEGKFGRLKDDREKCAKAKEALELTDTGLLSGSEERVQ
VALEELQDLKGVWSELSKVWEQIDQMKEQPWVSVQPRKLRQNLDALLNQLKSFPARLRQY
ASYEFVQRLLKGYMKINMLV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7z8fe	0.399	0.147	0.000	4579	0.969	0.296	7z8fe.pdb.gz	Structure of dynein-dynactin on microtubules shows tandem adaptor binding.
2	PDB:7z8jf	0.320	0.555	1.371E-67	674	0.480	0.997	7z8jf.pdb.gz
3	AFDB:A0A0R4IUQ6	0.252	0.503	6.124E-15	614	0.079	0.181	A0A0R4IUQ6.pdb.gz
4	PDB:7kzmC	0.180	0.079	3.948E-10	3890	0.119	0.043	7kzmC.pdb.gz	Structure of a microtubule-bound axonemal dynein.
5	AFDB:Q5SX07	0.215	0.560	8.064E-9	457	0.052	0.160	Q5SX07.pdb.gz	Q5SX07_MOUSE Dynein, axonemal, heavy chain 9 OS=Mus musculus OX=10090 GN=Dnah9 PE=1 SV=1
6	AFDB:Q9VN30	0.108	0.134	2.991E-8	1079	0.070	0.091	Q9VN30.pdb.gz	Q9VN30_DROME Dynein heavy chain linker domain-containing protein OS=Drosophila melanogaster OX=7227 GN=sac PE=4 SV=3
7	PDB:7z8jn	0.085	0.790	4.349E-7	126	0.089	0.984	7z8jn.pdb.gz
8	PDB:7jq9A	0.075	0.053	1.402E-4	2427	0.126	0.073	7jq9A.pdb.gz
9	PDB:7mq8LM	0.078	0.063	3.564E-3	2005	0.122	0.085	7mq8LM.pdb.gz	Nucleolar maturation of the human small subunit processome.
10	PDB:7sukSP	0.068	0.056	3.564E-3	2234	0.112	0.070	7sukSP.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
11	AFDB:Q8BXT7	0.096	0.534	3.814E-3	203	0.024	0.163	Q8BXT7.pdb.gz	Q8BXT7_MOUSE Uncharacterized protein OS=Mus musculus OX=10090 GN=Dnah9 PE=2 SV=1
12	AFDB:Q9VDW3	0.071	0.062	5.514E-3	1669	0.120	0.101	Q9VDW3.pdb.gz	DMDB_DROME Dystrophin, isoform B OS=Drosophila melanogaster OX=7227 GN=Dys PE=1 SV=3
13	PDB:7otmA	0.058	0.035	6.589E-3	3656	0.113	0.043	7otmA.pdb.gz	Structural insights into inhibitor regulation of the DNA repair protein DNA-PKcs.
14	AFDB:D6XEJ8	0.125	0.104	9.014E-3	1736	0.034	0.028	D6XEJ8.pdb.gz	D6XEJ8_TRYB2 Flagellar Member 4 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1D20.10 PE=4 SV=1
15	PDB:7lt3C	0.051	0.029	9.925E-3	3720	0.116	0.044	7lt3C.pdb.gz	Structural basis of long-range to short-range synaptic transition in NHEJ.
16	AFDB:F5HSE3	0.061	0.044	1.019E-2	2381	0.121	0.071	F5HSE3.pdb.gz	NIPLA_DANRE Nipped-B-like protein A OS=Danio rerio OX=7955 GN=nipbla PE=2 SV=1
17	PDB:6n1zA	0.060	0.077	1.269E-2	961	0.083	0.121	6n1zA.pdb.gz
18	AFDB:Q9P6L5	0.062	0.075	2.615E-2	1102	0.104	0.132	Q9P6L5.pdb.gz	SLA2_SCHPO Endocytosis protein end4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=end4 PE=1 SV=2
19	AFDB:F4K7F5	0.077	0.113	7.280E-2	814	0.059	0.102	F4K7F5.pdb.gz	F4K7F5_ARATH Exocyst complex component 84B OS=Arabidopsis thaliana OX=3702 GN=EXO84B PE=1 SV=1
20	AFDB:Q2U538	0.072	0.072	8.576E-2	1136	0.114	0.141	Q2U538.pdb.gz	Q2U538_ASPOR Cytoskeleton assembly control protein Sla2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090020000087 PE=3 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P34036	0.0	1139	4730	0.434	0.129	DYHC_DICDI Dynein heavy chain, cytoplasmic OS=Dictyostelium discoideum OX=44689 GN=dhcA PE=1 SV=2
2	P37276	0.0	1919	4639	0.657	0.198	DYHC_DROME Dynein heavy chain, cytoplasmic OS=Drosophila melanogaster OX=7227 GN=Dhc64C PE=2 SV=2
3	P38650	0.0	2840	4644	0.988	0.298	DYHC1_RAT Cytoplasmic dynein 1 heavy chain 1 OS=Rattus norvegicus OX=10116 GN=Dync1h1 PE=1 SV=1
4	P45444	0.0	1064	4345	0.408	0.131	DYHC_EMENI Dynein heavy chain, cytoplasmic OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=nudA PE=3 SV=2
5	Q14204	0.0	2879	4646	1.000	0.301	DYHC1_HUMAN Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5
6	Q19020	0.0	1226	4568	0.444	0.136	DYHC_CAEEL Dynein heavy chain, cytoplasmic OS=Caenorhabditis elegans OX=6239 GN=dhc-1 PE=1 SV=1
7	Q2LEK1	0.0	2627	4643	0.914	0.276	Q2LEK1_DANRE Cytoplasmic dynein 1 heavy chain 1 OS=Danio rerio OX=7955 GN=fk70a07 PE=1 SV=1
8	Q2U6C3	0.0	1072	4346	0.415	0.134	Q2U6C3_ASPOR Dynein heavy chain, cytoplasmic OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090120000298 PE=4 SV=1
9	Q9JHU4	0.0	2853	4644	0.992	0.299	DYHC1_MOUSE Cytoplasmic dynein 1 heavy chain 1 OS=Mus musculus OX=10090 GN=Dync1h1 PE=1 SV=2
10	A0A1D8PK53	3.91e-103	367	4161	0.235	0.079	A0A1D8PK53_CANAL Dynein heavy chain, cytoplasmic OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DYN1 PE=4 SV=1
11	O13290	1.50e-68	258	4196	0.158	0.053	DYHC_SCHPO Dynein heavy chain, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dhc1 PE=1 SV=1
12	P36022	3.65e-65	247	4092	0.193	0.066	DYHC_YEAST Dynein heavy chain, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DYN1 PE=1 SV=1
13	Q4QBN6	5.21e-19	96.7	5635	0.104	0.026	Q4QBN6_LEIMA Putative dynein heavy chain, cytosolic OS=Leishmania major OX=5664 GN=LMJF_22_1110 PE=4 SV=1
14	Q57YC6	1.51e-18	95.1	5290	0.091	0.024	Q57YC6_TRYB2 Dynein heavy chain, cytosolic, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.13M20.140 PE=4 SV=1
15	Q9SMH5	1.57e-13	78.6	4334	0.125	0.040	DYHC2_CHLRE Cytoplasmic dynein 2 heavy chain 1 OS=Chlamydomonas reinhardtii OX=3055 GN=DHC1B PE=1 SV=2
16	Q8NCM8	1.74e-13	78.6	4307	0.076	0.025	DYHC2_HUMAN Cytoplasmic dynein 2 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC2H1 PE=1 SV=4
17	Q45VK7	3.19e-13	77.8	4306	0.102	0.033	DYHC2_MOUSE Cytoplasmic dynein 2 heavy chain 1 OS=Mus musculus OX=10090 GN=Dync2h1 PE=1 SV=1
18	Q9JJ79	5.99e-13	76.6	4306	0.097	0.032	DYHC2_RAT Cytoplasmic dynein 2 heavy chain 1 OS=Rattus norvegicus OX=10116 GN=Dync2h1 PE=1 SV=1
19	E7FGT8	5.41e-08	60.5	4626	0.050	0.015	E7FGT8_DANRE Dynein heavy chain 10, axonemal OS=Danio rerio OX=7955 GN=si:dkeyp-86b9.1 PE=1 SV=2
20	D6XEZ2	7.59e-08	60.1	4232	0.062	0.021	D6XEZ2_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.5D20.720 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08385 DHC_N1	1e-132	455.4	Dynein heavy chain, N-terminal region 1
2	PF08393 DHC_N2	0.0042	27.9	Dynein heavy chain, N-terminal region 2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000019304

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000004847	0.998	Dynein, cytoplasmic 1, light intermediate chain 2
2	61853.ENSNLEP00000005254	0.997	Dynein, cytoplasmic 1, light intermediate chain 1
3	61853.ENSNLEP00000019011	0.995	Dynein, light chain, LC8-type 1
4	61853.ENSNLEP00000019328	0.994	Dynein, cytoplasmic 1, intermediate chain 1
5	61853.ENSNLEP00000023520	0.994	Dynein, light chain, LC8-type 2
6	61853.ENSNLEP00000006627	0.991	Dynein, cytoplasmic 1, intermediate chain 2
7	61853.ENSNLEP00000000706	0.989	Dynactin 1
8	61853.ENSNLEP00000012297	0.988	Uncharacterized protein
9	61853.ENSNLEP00000020907	0.987	Platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa)
10	61853.ENSNLEP00000020337	0.986	Dynein, cytoplasmic 2, light intermediate chain 1
11	61853.ENSNLEP00000020994	0.986	Dynactin 2 (p50)
12	61853.ENSNLEP00000013251	0.985	Dynein, light chain, Tctex-type 1
13	61853.ENSNLEP00000008770	0.977	Dynein, cytoplasmic 2, heavy chain 1
14	61853.ENSNLEP00000012176	0.967	nudE neurodevelopment protein 1-like 1
15	61853.ENSNLEP00000014601	0.959	Dynactin 5 (p25)
16	61853.ENSNLEP00000012678	0.957	Dynein light chain roadblock
17	61853.ENSNLEP00000018415	0.956	ARP1 actin-related protein 1 homolog A, centractin alpha (yeast)
18	61853.ENSNLEP00000013677	0.947	Tubulin beta chain
19	61853.ENSNLEP00000020031	0.928	BICD cargo adaptor 2
20	61853.ENSNLEP00000014189	0.926	ARP1 actin-related protein 1 homolog B, centractin beta (yeast)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003777	1.000	microtubule motor activity
GO:0008569	0.985	minus-end-directed microtubule motor activity
GO:0097159	0.973	organic cyclic compound binding
GO:0051959	0.944	dynein light intermediate chain binding
GO:1901363	0.928	heterocyclic compound binding
GO:0003723	0.841	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.887	cellular process
GO:0032502	0.322	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043227	0.996	membrane-bounded organelle
GO:0043232	0.996	intracellular non-membrane-bounded organelle
GO:0043231	0.992	intracellular membrane-bounded organelle
GO:0005856	0.992	cytoskeleton
GO:0015630	0.984	microtubule cytoskeleton
GO:0032991	0.958	protein-containing complex
GO:0012505	0.917	endomembrane system
GO:0005829	0.814	cytosol
GO:0099080	0.746	supramolecular complex
GO:0005634	0.735	nucleus
GO:0120025	0.732	plasma membrane bounded cell projection
GO:0005875	0.718	microtubule associated complex
GO:1902494	0.649	catalytic complex
GO:0043233	0.576	organelle lumen
GO:0070013	0.560	intracellular organelle lumen
GO:0005576	0.496	extracellular region
GO:0016020	0.468	membrane
GO:0031982	0.443	vesicle
GO:0030286	0.407	dynein complex
GO:0097708	0.405	intracellular vesicle
GO:0031410	0.402	cytoplasmic vesicle
GO:0005615	0.368	extracellular space
GO:0043230	0.353	extracellular organelle
GO:0071944	0.345	cell periphery
GO:1903561	0.337	extracellular vesicle
GO:0070062	0.329	extracellular exosome
GO:0005886	0.302	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]