StarFunc result for job id Q14207

User Input

>input (1427 residues)
MLLPSDVARLVLGYLQQENLISTCQTFILESSDLKEYAEHCTDEGFIPACLLSLFGKNLT
TILNEYVAMKTKETSNNVPAIMSSLWKKLDHTLSQIRSMQSSPRFAGSQRARTRTGIAEI
KRQRKLASQTAPASAELLTLPYLSGQFTTPPSTGTQVTRPSGQISDPSRSYFVVVNHSQS
QDTVTTGEALNVIPGAQEKKAHASLMSPGRRKSESQRKSTTLSGPHSTIRNFQDPNAFAV
EKQMVIENAREKILSNKSLQEKLAENINKFLTSDNNIAQVPKQTDNNPTEPETSIDEFLG
LPSEIHMSEEAIQDILEQTESDPAFQALFDLFDYGKTKNNKNISQSISSQPMESNPSIVL
ADETNLAVKGSFETEESDGQSGQPAFCTSYQNDDPLNALKNSNNHDVLRQEDQENFSQIS
TSIQKKAFKTAVPTEQKCDIDITFESVPNLNDFNQRGNSNAECNPHCAELYTNQMSTETE
MAIGIEKNSLSSNVPSESQLQPDQPDIPITSFVSLGCEANNENLILSGKSSQLLSQDTSL
TGKPSKKSQFCENSNDTVKLKINFHGSKSSDSSEVHKSKIEINVLEPVMSQLSNCQDNSC
LQSEILPVSVESSHLNVSGQVEIHLGDSLSSTKQPSNDSASVELNHTENEAQASKSENSQ
EPSSSVKEENTIFLSLGGNANCEKVALTPPEGTPVENSHSLPPESVCSSVGDSHPESQNT
DDKPSSNNSAEIDASNIVSLKVIISDDPFVSSDTELTSAVSSINGENLPTIILSSPTKSP
TKNAELVKCLSSEETVGAVVYAEVGDSASMEQSLLTFKSEDSAVNNTQNEDGIAFSANVT
PCVSKDGGYIQLMPATSTAFGNSNNILIATCVTDPTALGTSVSQSNVVVLPGNSAPMTAQ
PLPPQLQTPPRSNSVFAVNQAVSPNFSQGSAIIIASPVQPVLQGMVGMIPVSVVGQNGNN
FSTPPRQVLHMPLTAPVCNRSIPQFPVPPKSQKAQGLRNKPCIGKQVNNLVDSSGHSVGC
HAQKTEVSDKSIATDLGKKSEETTVPFPEESIVPAAKPCHRRVLCFDSTTAPVANTQGPN
HKMVSQNKERNAVSFPNLDSPNVSSTLKPPSNNAIKREKEKPPLPKILSKSESAISRHTT
IRETQSEKKVSPTEIVLESFHKATANKENELCSDVERQKNPENSKLSIGQQNGGLRSEKS
IASLQEMTKKQGTSSNNKNVLSVGTAVKDLKQEQTKSASSLITTEMLQDIQRHSSVSRLA
DSSDLPVPRTPGSGAGEKHKEEPIDIIKAPSSRRFSEDSSTSKVMVPPVTPDLPACSPAS
ETGSENSVNMAAHTLMILSRAAISRTTSATPLKDNTQQFRASSRSTTKKRKIEELDERER
NSRPSSKNLTNSSIPMKKKKIKKKKLPSSFPAGMDVDKFLLSLHYDE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14207	1.000	1.000	0.000	1427	1.000	1.000	Q14207.pdb.gz	NPAT_HUMAN Protein NPAT OS=Homo sapiens OX=9606 GN=NPAT PE=1 SV=3
2	AFDB:Q8BMA5	0.090	0.091	0.000	1420	0.748	0.751	Q8BMA5.pdb.gz	NPAT_MOUSE Protein NPAT OS=Mus musculus OX=10090 GN=Npat PE=1 SV=2
3	AFDB:Q9W363	0.054	0.043	4.681E-9	1837	0.172	0.133	Q9W363.pdb.gz	Q9W363_DROME Multi sex combs, isoform A OS=Drosophila melanogaster OX=7227 GN=mxc PE=4 SV=2
4	AFDB:Q8R4U7	0.043	0.052	3.620E-4	1068	0.103	0.138	Q8R4U7.pdb.gz	LUZP1_MOUSE Leucine zipper protein 1 OS=Mus musculus OX=10090 GN=Luzp1 PE=1 SV=2
5	AFDB:Q86V48	0.035	0.042	6.764E-4	1076	0.116	0.154	Q86V48.pdb.gz	LUZP1_HUMAN Leucine zipper protein 1 OS=Homo sapiens OX=9606 GN=LUZP1 PE=1 SV=2
6	AFDB:F4J7T3	0.035	0.029	7.201E-4	1957	0.134	0.098	F4J7T3.pdb.gz	EAF1A_ARATH Chromatin modification-related protein EAF1 A OS=Arabidopsis thaliana OX=3702 GN=EAF1A PE=1 SV=1
7	AFDB:Q5YL88	0.029	0.034	1.048E-3	1205	0.125	0.149	Q5YL88.pdb.gz	Q5YL88_MOUSE Histone-lysine N-methyltransferase, H3 lysine-79 specific (Fragment) OS=Mus musculus OX=10090 GN=Dot1l PE=2 SV=1
8	AFDB:P28290	0.042	0.046	1.525E-3	1259	0.128	0.145	P28290.pdb.gz	ITPI2_HUMAN Protein ITPRID2 OS=Homo sapiens OX=9606 GN=ITPRID2 PE=1 SV=3
9	AFDB:Q6XZL8	0.035	0.034	1.840E-3	1540	0.113	0.105	Q6XZL8.pdb.gz	Q6XZL8_MOUSE Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Mus musculus OX=10090 GN=Dot1l PE=1 SV=1
10	AFDB:Q5U0U1	0.044	0.047	3.034E-3	1267	0.107	0.120	Q5U0U1.pdb.gz	Q5U0U1_DROME AT17006p OS=Drosophila melanogaster OX=7227 GN=salr PE=2 SV=1
11	PDB:4n78F	0.031	0.173	1.046	156	0.018	0.160	4n78F.pdb.gz	The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
12	PDB:5o9zL	0.036	0.093	2.081	459	0.005	0.015	5o9zL.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
13	PDB:6q8fA	0.029	0.149	4.140	197	0.013	0.091	6q8fA.pdb.gz
14	PDB:3iqcA	0.026	0.199	5.316	119	0.008	0.101	3iqcA.pdb.gz
15	PDB:7qooQ	0.030	0.140	5.316	209	0.014	0.096	7qooQ.pdb.gz	Structure of the human inner kinetochore CCAN complex and its significance for human centromere organization.
16	PDB:6hivDA	0.033	0.031	5.659	1557	0.011	0.010	6hivDA.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
17	PDB:6hiyDA	0.033	0.033	5.659	1426	0.011	0.011	6hiyDA.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
18	PDB:6qlfU	0.039	0.200	5.659	171	0.015	0.129	6qlfU.pdb.gz
19	PDB:6nmiC	0.022	0.053	6.413	408	0.011	0.039	6nmiC.pdb.gz	The complete structure of the human TFIIH core complex.
20	PDB:7vnrA	0.027	0.085	6.413	333	0.015	0.063	7vnrA.pdb.gz	Structural insights into the lipid and ligand regulation of a human neuronal KCNQ channel.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14207	0.0	2900	1427	1.000	1.000	NPAT_HUMAN Protein NPAT OS=Homo sapiens OX=9606 GN=NPAT PE=1 SV=3
2	Q8BMA5	0.0	2011	1420	0.748	0.751	NPAT_MOUSE Protein NPAT OS=Mus musculus OX=10090 GN=Npat PE=1 SV=2
3	P30427	3.0	35.0	4687	0.018	0.005	PLEC_RAT Plectin OS=Rattus norvegicus OX=10116 GN=Plec PE=1 SV=2
4	Q9QXS1	3.2	35.0	4691	0.018	0.005	PLEC_MOUSE Plectin OS=Mus musculus OX=10090 GN=Plec PE=1 SV=3
5	Q9JI55	4.5	34.3	4473	0.018	0.006	PLEC_CRIGR Plectin (Fragment) OS=Cricetulus griseus OX=10029 GN=PLEC PE=1 SV=1
6	Q15149	6.2	33.9	4684	0.018	0.005	PLEC_HUMAN Plectin OS=Homo sapiens OX=9606 GN=PLEC PE=1 SV=3
7	Q5PR31	7.9	32.7	279	0.020	0.100	Q5PR31_DANRE CD2-associated protein like OS=Danio rerio OX=7955 GN=cd2apl PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17814 LisH_TPL	55	14.8	LisH-like dimerisation domain
2	PF15712 NPAT_C	0	1178.6	NPAT C terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000278612

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000318085	0.904	Histone H4 transcription factor
2	9606.ENSP00000266970	0.861	Cyclin-dependent kinase 2
3	9606.ENSP00000352925	0.815	Transformation/transcription domain-associated protein
4	9606.ENSP00000286307	0.797	U7 snRNA-associated Sm-like protein LSm11
5	9606.ENSP00000262643	0.785	G1/S-specific cyclin-E1
6	9606.ENSP00000319341	0.782	U7 snRNA-associated Sm-like protein LSm10
7	9606.ENSP00000478179	0.701	CASP8-associated protein 2
8	9606.ENSP00000367034	0.672	Histone cluster 1 H4 family member c
9	9606.ENSP00000311492	0.655	Intestine-specific homeobox
10	9606.ENSP00000265838	0.641	Acetyl-CoA acetyltransferase, mitochondrial
11	9606.ENSP00000417686	0.639	Histone RNA hairpin-binding protein
12	9606.ENSP00000315386	0.594	KDEL motif-containing protein 2
13	9606.ENSP00000402084	0.573	Wee1-like protein kinase
14	9606.ENSP00000483537	0.569	Uncharacterized protein C11orf65
15	9606.ENSP00000244537	0.567	Histone cluster 1 H4 family member f
16	9606.ENSP00000265843	0.541	Exophilin-5
17	9606.ENSP00000326579	0.510	Cytochrome c-type heme lyase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003714	1.000	transcription corepressor activity
GO:0003713	1.000	transcription coactivator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0048518	0.981	positive regulation of biological process
GO:0019222	0.980	regulation of metabolic process
GO:0048522	0.966	positive regulation of cellular process
GO:0022402	0.964	cell cycle process
GO:0060255	0.962	regulation of macromolecule metabolic process
GO:0051171	0.957	regulation of nitrogen compound metabolic process
GO:0031323	0.957	regulation of cellular metabolic process
GO:0080090	0.956	regulation of primary metabolic process
GO:0009893	0.951	positive regulation of metabolic process
GO:0010468	0.946	regulation of gene expression
GO:0031326	0.938	regulation of cellular biosynthetic process
GO:0019219	0.937	regulation of nucleobase-containing compound metabolic process
GO:0031325	0.937	positive regulation of cellular metabolic process
GO:0010556	0.935	regulation of macromolecule biosynthetic process
GO:0044770	0.910	cell cycle phase transition
GO:0010604	0.910	positive regulation of macromolecule metabolic process
GO:0000278	0.907	mitotic cell cycle
GO:1903047	0.888	mitotic cell cycle process
GO:0006355	0.885	regulation of DNA-templated transcription
GO:0044772	0.840	mitotic cell cycle phase transition
GO:0051173	0.838	positive regulation of nitrogen compound metabolic process
GO:0044843	0.833	cell cycle G1/S phase transition
GO:0045935	0.755	positive regulation of nucleobase-containing compound metabolic process
GO:0000082	0.716	G1/S transition of mitotic cell cycle
GO:0009891	0.674	positive regulation of biosynthetic process
GO:0031328	0.640	positive regulation of cellular biosynthetic process
GO:0006357	0.569	regulation of transcription by RNA polymerase II
GO:0000083	0.508	regulation of transcription involved in G1/S transition of mitotic cell cycle
GO:0010557	0.501	positive regulation of macromolecule biosynthetic process
GO:0045893	0.350	positive regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0015030	0.998	Cajal body
GO:0032991	0.917	protein-containing complex
GO:0005829	0.844	cytosol
GO:0043228	0.757	non-membrane-bounded organelle
GO:0097504	0.757	Gemini of coiled bodies
GO:0043232	0.703	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]