StarFunc result for job id Q14209

User Input

>input (437 residues)
MLQGPRALASAAGQTPKVVPAMSPTELWPSGLSSPQLCPATATYYTPLYPQTAPPAAAPG
TCLDATPHGPEGQVVRCLPAGRLPAKRKLDLEGIGRPVVPEFPTPKGKCIRVDGLPSPKT
PKSPGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQ
LIRKKAKNNIQWVGRGMFEDPTRPGKQQQLGQELKELMNTEQALDQLIQSCSLSFKHLTE
DKANKRLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVPDRTEDNLQIYLKSTQGPIEV
YLCPEEVQEPDSPSEEPLPSTSTLCPSPDSAQPSSSTDPSIMEPTASSVPAPAPTPQQAP
PPPSLVPLEATDSLLELPHPLLQQTEDQFLSPTLACSSPLISFSPSLDQDDYLWGLEAGE
GISDLFDSYDLGDLLIN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14209	1.000	1.000	6.458E-69	437	1.000	1.000	Q14209.pdb.gz	E2F2_HUMAN Transcription factor E2F2 OS=Homo sapiens OX=9606 GN=E2F2 PE=1 SV=1
2	AFDB:P56931	0.467	0.461	2.049E-55	443	0.840	0.828	P56931.pdb.gz	E2F2_MOUSE Transcription factor E2F2 OS=Mus musculus OX=10090 GN=E2f2 PE=1 SV=2
3	AFDB:O00716	0.336	0.318	2.061E-31	465	0.462	0.434	O00716.pdb.gz	E2F3_HUMAN Transcription factor E2F3 OS=Homo sapiens OX=9606 GN=E2F3 PE=1 SV=1
4	AFDB:O09139	0.348	0.352	2.544E-27	432	0.405	0.410	O09139.pdb.gz	E2F1_RAT Transcription factor E2F1 OS=Rattus norvegicus OX=10116 GN=E2f1 PE=1 SV=2
5	AFDB:Q01094	0.373	0.373	4.477E-27	437	0.396	0.396	Q01094.pdb.gz	E2F1_HUMAN Transcription factor E2F1 OS=Homo sapiens OX=9606 GN=E2F1 PE=1 SV=1
6	AFDB:A0A0S2Z3K8	0.347	0.504	1.675E-23	281	0.243	0.377	A0A0S2Z3K8.pdb.gz	A0A0S2Z3K8_HUMAN E2F transcription factor 6 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=E2F6 PE=2 SV=1
7	AFDB:O54917	0.352	0.538	6.670E-23	272	0.238	0.382	O54917.pdb.gz	E2F6_MOUSE Transcription factor E2F6 OS=Mus musculus OX=10090 GN=E2f6 PE=2 SV=2
8	AFDB:Q9FV71	0.291	0.275	1.331E-22	469	0.309	0.288	Q9FV71.pdb.gz	E2FB_ARATH Transcription factor E2FB OS=Arabidopsis thaliana OX=3702 GN=E2FB PE=1 SV=1
9	AFDB:Q15329	0.275	0.341	2.548E-21	346	0.288	0.364	Q15329.pdb.gz	E2F5_HUMAN Transcription factor E2F5 OS=Homo sapiens OX=9606 GN=E2F5 PE=1 SV=1
10	AFDB:Q9FV70	0.292	0.316	4.483E-21	396	0.231	0.255	Q9FV70.pdb.gz	E2FC_ARATH Transcription factor E2FC OS=Arabidopsis thaliana OX=3702 GN=E2FC PE=1 SV=1
11	PDB:4fx0B	0.119	0.327	2.695E-2	135	0.050	0.163	4fx0B.pdb.gz
12	PDB:4zzlA	0.117	0.314	6.915E-2	146	0.055	0.164	4zzlA.pdb.gz
13	PDB:5l4kR	0.125	0.138	6.915E-2	389	0.037	0.041	5l4kR.pdb.gz
14	PDB:6hivBN	0.117	0.215	7.363E-2	214	0.043	0.089	6hivBN.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
15	PDB:4ev0D	0.130	0.250	8.889E-2	214	0.011	0.023	4ev0D.pdb.gz	Crystal Structure of T. thermophilius Catabolite Activator Protein
16	PDB:5l4kO	0.126	0.143	8.889E-2	376	0.016	0.019	5l4kO.pdb.gz
17	PDB:2zcwA	0.117	0.245	1.008E-1	194	0.025	0.057	2zcwA.pdb.gz
18	PDB:4a6dA	0.118	0.147	1.008E-1	345	0.021	0.026	4a6dA.pdb.gz	Crystal Structure and Functional Mapping of Human Asmt, the Last Enzyme of the Melatonin Synthesis Pathway.
19	PDB:4byyA	0.121	0.218	1.008E-1	226	0.025	0.049	4byyA.pdb.gz
20	PDB:1ft9A	0.117	0.222	1.143E-1	210	0.018	0.038	1ft9A.pdb.gz	Structure of the CO sensing transcription activator CooA.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P56931	0.0	680	443	0.824	0.813	E2F2_MOUSE Transcription factor E2F2 OS=Mus musculus OX=10090 GN=E2f2 PE=1 SV=2
2	Q14209	0.0	878	437	1.000	1.000	E2F2_HUMAN Transcription factor E2F2 OS=Homo sapiens OX=9606 GN=E2F2 PE=1 SV=1
3	O00716	6.87e-103	315	465	0.465	0.437	E2F3_HUMAN Transcription factor E2F3 OS=Homo sapiens OX=9606 GN=E2F3 PE=1 SV=1
4	O35261	1.70e-100	309	457	0.465	0.444	E2F3_MOUSE Transcription factor E2F3 OS=Mus musculus OX=10090 GN=E2f3 PE=1 SV=2
5	Q01094	1.26e-78	252	437	0.394	0.394	E2F1_HUMAN Transcription factor E2F1 OS=Homo sapiens OX=9606 GN=E2F1 PE=1 SV=1
6	Q61501	2.61e-73	238	430	0.387	0.393	E2F1_MOUSE Transcription factor E2F1 OS=Mus musculus OX=10090 GN=E2f1 PE=1 SV=1
7	O09139	5.06e-73	237	432	0.384	0.389	E2F1_RAT Transcription factor E2F1 OS=Rattus norvegicus OX=10116 GN=E2f1 PE=1 SV=2
8	A0A0S2Z3K8	7.30e-56	188	281	0.215	0.335	A0A0S2Z3K8_HUMAN E2F transcription factor 6 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=E2F6 PE=2 SV=1
9	O75461	7.30e-56	188	281	0.215	0.335	E2F6_HUMAN Transcription factor E2F6 OS=Homo sapiens OX=9606 GN=E2F6 PE=1 SV=1
10	O54917	1.15e-55	187	272	0.224	0.360	E2F6_MOUSE Transcription factor E2F6 OS=Mus musculus OX=10090 GN=E2f6 PE=2 SV=2
11	Q53YM3	3.52e-51	173	206	0.195	0.413	Q53YM3_HUMAN E2F transcription factor 6, isoform CRA_d OS=Homo sapiens OX=9606 GN=E2F6 PE=2 SV=1
12	Q9FV71	6.35e-49	175	469	0.311	0.290	E2FB_ARATH Transcription factor E2FB OS=Arabidopsis thaliana OX=3702 GN=E2FB PE=1 SV=1
13	Q9FNY0	5.46e-45	165	485	0.215	0.194	E2FA_ARATH Transcription factor E2FA OS=Arabidopsis thaliana OX=3702 GN=E2FA PE=1 SV=1
14	Q6DE14	1.34e-43	158	375	0.297	0.347	E2F4_XENLA Transcription factor E2F4 OS=Xenopus laevis OX=8355 GN=e2f4 PE=1 SV=1
15	Q15329	3.11e-42	154	346	0.265	0.335	E2F5_HUMAN Transcription factor E2F5 OS=Homo sapiens OX=9606 GN=E2F5 PE=1 SV=1
16	Q9FV70	6.42e-42	154	396	0.185	0.205	E2FC_ARATH Transcription factor E2FC OS=Arabidopsis thaliana OX=3702 GN=E2FC PE=1 SV=1
17	Q16254	9.37e-41	152	413	0.215	0.228	E2F4_HUMAN Transcription factor E2F4 OS=Homo sapiens OX=9606 GN=E2F4 PE=1 SV=2
18	Q61502	1.02e-40	150	335	0.270	0.352	E2F5_MOUSE Transcription factor E2F5 OS=Mus musculus OX=10090 GN=E2f5 PE=1 SV=2
19	Q8R0K9	2.01e-40	150	410	0.215	0.229	E2F4_MOUSE Transcription factor E2F4 OS=Mus musculus OX=10090 GN=E2f4 PE=1 SV=1
20	Q62814	2.69e-39	145	300	0.270	0.393	E2F5_RAT Transcription factor E2F5 (Fragment) OS=Rattus norvegicus OX=10116 GN=E2f5 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16421 E2F_CC-MB	2.3e-31	119.2	E2F transcription factor CC-MB domain
2	PF02319 E2F_TDP	4.5e-23	92.2	E2F/DP family winged-helix DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355249

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000267163	0.998	Retinoblastoma-associated protein
2	9606.ENSP00000364519	0.997	Transcription factor Dp-1
3	9606.ENSP00000262238	0.986	Transcriptional repressor protein YY1
4	9606.ENSP00000362768	0.986	Retinoblastoma-like protein 1
5	9606.ENSP00000420616	0.983	Transcription factor Dp-2
6	9606.ENSP00000274026	0.982	Cyclin-A2
7	9606.ENSP00000257904	0.980	Cyclin-dependent kinase 4
8	9606.ENSP00000429089	0.977	G1/S-specific cyclin-E2
9	9606.ENSP00000265734	0.976	Cyclin-dependent kinase 6
10	9606.ENSP00000266970	0.974	Cyclin-dependent kinase 2
11	9606.ENSP00000262643	0.972	G1/S-specific cyclin-E1
12	9606.ENSP00000419494	0.972	RING1 and YY1-binding protein
13	9606.ENSP00000227507	0.970	G1/S-specific cyclin-D1
14	9606.ENSP00000418915	0.964	Cyclin-dependent kinase inhibitor 2A
15	9606.ENSP00000261254	0.963	G1/S-specific cyclin-D2
16	9606.ENSP00000362082	0.963	G1/S-specific cyclin-D3
17	9606.ENSP00000384849	0.960	Cyclin-dependent kinase inhibitor 1
18	9606.ENSP00000228872	0.953	Cyclin-dependent kinase inhibitor 1B
19	9606.ENSP00000320147	0.949	Histone-lysine N-methyltransferase EZH2
20	9606.ENSP00000345571	0.946	Transcription factor E2F1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000981	0.999	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000987	0.999	cis-regulatory region sequence-specific DNA binding
GO:0001216	0.997	DNA-binding transcription activator activity
GO:0000977	0.991	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001228	0.867	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0080090	0.996	regulation of primary metabolic process
GO:0060255	0.996	regulation of macromolecule metabolic process
GO:0031323	0.996	regulation of cellular metabolic process
GO:0051171	0.995	regulation of nitrogen compound metabolic process
GO:0009987	0.993	cellular process
GO:0051252	0.993	regulation of RNA metabolic process
GO:0010468	0.976	regulation of gene expression
GO:0048518	0.975	positive regulation of biological process
GO:0009889	0.972	regulation of biosynthetic process
GO:0048522	0.970	positive regulation of cellular process
GO:0010556	0.963	regulation of macromolecule biosynthetic process
GO:0031326	0.963	regulation of cellular biosynthetic process
GO:0006355	0.945	regulation of DNA-templated transcription
GO:0009893	0.934	positive regulation of metabolic process
GO:0010604	0.908	positive regulation of macromolecule metabolic process
GO:0048519	0.890	negative regulation of biological process
GO:0051173	0.886	positive regulation of nitrogen compound metabolic process
GO:0031325	0.885	positive regulation of cellular metabolic process
GO:0006357	0.865	regulation of transcription by RNA polymerase II
GO:0010557	0.860	positive regulation of macromolecule biosynthetic process
GO:0051254	0.860	positive regulation of RNA metabolic process
GO:0031328	0.859	positive regulation of cellular biosynthetic process
GO:1902680	0.818	positive regulation of RNA biosynthetic process
GO:0008152	0.800	metabolic process
GO:0045893	0.769	positive regulation of DNA-templated transcription
GO:0071704	0.747	organic substance metabolic process
GO:0044238	0.740	primary metabolic process
GO:0006807	0.710	nitrogen compound metabolic process
GO:0043170	0.681	macromolecule metabolic process
GO:0044237	0.667	cellular metabolic process
GO:0048523	0.659	negative regulation of cellular process
GO:0045944	0.647	positive regulation of transcription by RNA polymerase II
GO:0050896	0.577	response to stimulus
GO:0051716	0.460	cellular response to stimulus
GO:0051726	0.454	regulation of cell cycle
GO:0034641	0.432	cellular nitrogen compound metabolic process
GO:1901360	0.412	organic cyclic compound metabolic process
GO:0046483	0.412	heterocycle metabolic process
GO:0006725	0.412	cellular aromatic compound metabolic process
GO:0006139	0.389	nucleobase-containing compound metabolic process
GO:0090304	0.348	nucleic acid metabolic process
GO:0007049	0.329	cell cycle
GO:0007154	0.303	cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0032991	0.982	protein-containing complex
GO:0043232	0.940	intracellular non-membrane-bounded organelle
GO:0140513	0.851	nuclear protein-containing complex
GO:0005737	0.766	cytoplasm
GO:0005667	0.724	transcription regulator complex
GO:0090575	0.650	RNA polymerase II transcription regulator complex
GO:0005829	0.548	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]