StarFunc result for job id Q14213

User Input

>input (229 residues)
MTPQLLLALVLWASCPPCSGRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPV
SFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVP
FITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRV
GPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14213	1.000	1.000	1.226E-42	229	1.000	1.000	Q14213.pdb.gz	IL27B_HUMAN Interleukin-27 subunit beta OS=Homo sapiens OX=9606 GN=EBI3 PE=1 SV=2
2	PDB:7u7nC	0.854	0.976	2.272E-33	200	0.873	1.000	7u7nC.pdb.gz
3	AFDB:O35228	0.851	0.855	1.719E-28	228	0.598	0.601	O35228.pdb.gz	IL27B_MOUSE Interleukin-27 subunit beta OS=Mus musculus OX=10090 GN=Ebi3 PE=1 SV=1
4	PDB:7z0lB	0.671	0.438	8.343E-25	370	0.541	0.335	7z0lB.pdb.gz
5	AFDB:A4JYQ0	0.796	0.518	3.294E-18	357	0.284	0.182	A4JYQ0.pdb.gz	A4JYQ0_DANRE Ciliary neurotrophic factor receptor OS=Danio rerio OX=7955 GN=cb549 PE=2 SV=1
6	AFDB:Q14626	0.752	0.421	1.811E-16	422	0.258	0.140	Q14626.pdb.gz	I11RA_HUMAN Interleukin-11 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL11RA PE=1 SV=2
7	AFDB:O88507	0.793	0.497	2.009E-16	372	0.271	0.167	O88507.pdb.gz	CNTFR_MOUSE Ciliary neurotrophic factor receptor subunit alpha OS=Mus musculus OX=10090 GN=Cntfr PE=1 SV=2
8	AFDB:Q64385	0.763	0.419	7.004E-16	432	0.253	0.134	Q64385.pdb.gz	I11RA_MOUSE Interleukin-11 receptor subunit alpha-1 OS=Mus musculus OX=10090 GN=Il11ra1 PE=1 SV=1
9	AFDB:P05710	0.730	0.290	6.150E-14	610	0.205	0.077	P05710.pdb.gz	PRLR_RAT Prolactin receptor OS=Rattus norvegicus OX=10116 GN=Prlr PE=1 SV=2
10	AFDB:Q9JM58	0.688	0.396	7.977E-14	425	0.240	0.129	Q9JM58.pdb.gz	CRLF1_MOUSE Cytokine receptor-like factor 1 OS=Mus musculus OX=10090 GN=Crlf1 PE=1 SV=1
11	AFDB:P08887	0.711	0.367	1.741E-13	468	0.201	0.098	P08887.pdb.gz	IL6RA_HUMAN Interleukin-6 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL6R PE=1 SV=1
12	AFDB:P16471	0.719	0.280	1.741E-13	622	0.205	0.076	P16471.pdb.gz	PRLR_HUMAN Prolactin receptor OS=Homo sapiens OX=9606 GN=PRLR PE=1 SV=1
13	PDB:5mj3A	0.630	0.488	1.774E-10	302	0.210	0.159	5mj3A.pdb.gz
14	PDB:6pxvA	0.382	0.127	2.620E-8	823	0.127	0.035	6pxvA.pdb.gz
15	PDB:8eyyA	0.397	0.136	1.994E-7	775	0.157	0.046	8eyyA.pdb.gz
16	PDB:8dtlA	0.393	0.139	6.599E-7	741	0.140	0.043	8dtlA.pdb.gz
17	PDB:6pyhD	0.345	0.118	1.598E-6	798	0.144	0.041	6pyhD.pdb.gz
18	PDB:3besR	0.445	0.417	4.296E-6	250	0.096	0.088	3besR.pdb.gz
19	PDB:7bwaA	0.317	0.132	3.627E-5	674	0.118	0.040	7bwaA.pdb.gz
20	PDB:1e07A	0.338	0.167	2.760E-4	642	0.131	0.047	1e07A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14213	1.29e-168	465	229	1.000	1.000	IL27B_HUMAN Interleukin-27 subunit beta OS=Homo sapiens OX=9606 GN=EBI3 PE=1 SV=2
2	O35228	1.47e-85	255	228	0.603	0.605	IL27B_MOUSE Interleukin-27 subunit beta OS=Mus musculus OX=10090 GN=Ebi3 PE=1 SV=1
3	A4JYQ0	3.18e-27	108	357	0.284	0.182	A4JYQ0_DANRE Ciliary neurotrophic factor receptor OS=Danio rerio OX=7955 GN=cb549 PE=2 SV=1
4	O88507	5.19e-24	100	372	0.266	0.164	CNTFR_MOUSE Ciliary neurotrophic factor receptor subunit alpha OS=Mus musculus OX=10090 GN=Cntfr PE=1 SV=2
5	P26992	6.90e-24	100	372	0.266	0.164	CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha OS=Homo sapiens OX=9606 GN=CNTFR PE=1 SV=2
6	Q08406	3.86e-23	97.8	372	0.262	0.161	CNTFR_RAT Ciliary neurotrophic factor receptor subunit alpha OS=Rattus norvegicus OX=10116 GN=Cntfr PE=2 SV=2
7	Q14626	1.42e-18	85.5	422	0.288	0.156	I11RA_HUMAN Interleukin-11 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL11RA PE=1 SV=2
8	Q99MF4	1.72e-17	82.4	431	0.284	0.151	I11RA_RAT Interleukin-11 receptor subunit alpha OS=Rattus norvegicus OX=10116 GN=Il11ra1 PE=2 SV=1
9	Q64385	2.47e-17	82.0	432	0.284	0.150	I11RA_MOUSE Interleukin-11 receptor subunit alpha-1 OS=Mus musculus OX=10090 GN=Il11ra1 PE=1 SV=1
10	Q62959	4.34e-10	61.2	1162	0.140	0.028	LEPR_RAT Leptin receptor OS=Rattus norvegicus OX=10116 GN=Lepr PE=1 SV=1
11	P48356	5.19e-09	58.2	1162	0.135	0.027	LEPR_MOUSE Leptin receptor OS=Mus musculus OX=10090 GN=Lepr PE=1 SV=1
12	P48357	1.42e-08	57.0	1165	0.140	0.027	LEPR_HUMAN Leptin receptor OS=Homo sapiens OX=9606 GN=LEPR PE=1 SV=2
13	P43432	3.16e-08	55.5	335	0.105	0.072	IL12B_MOUSE Interleukin-12 subunit beta OS=Mus musculus OX=10090 GN=Il12b PE=1 SV=1
14	E9PU71	5.10e-08	54.7	335	0.105	0.072	E9PU71_RAT Interleukin-12 subunit beta OS=Rattus norvegicus OX=10116 GN=Il12b PE=3 SV=2
15	Q9R278	5.29e-08	54.7	335	0.105	0.072	Q9R278_RAT Interleukin-12 subunit beta OS=Rattus norvegicus OX=10116 GN=Il12b PE=2 SV=1
16	Q9JM58	1.12e-07	53.9	425	0.266	0.144	CRLF1_MOUSE Cytokine receptor-like factor 1 OS=Mus musculus OX=10090 GN=Crlf1 PE=1 SV=1
17	P29460	1.64e-07	53.1	328	0.157	0.110	IL12B_HUMAN Interleukin-12 subunit beta OS=Homo sapiens OX=9606 GN=IL12B PE=1 SV=1
18	O75462	2.34e-07	52.8	422	0.253	0.137	CRLF1_HUMAN Cytokine receptor-like factor 1 OS=Homo sapiens OX=9606 GN=CRLF1 PE=1 SV=1
19	O60500	3.04e-07	52.8	1241	0.166	0.031	NPHN_HUMAN Nephrin OS=Homo sapiens OX=9606 GN=NPHS1 PE=1 SV=1
20	P46282	6.22e-07	51.6	327	0.153	0.107	IL12B_BOVIN Interleukin-12 subunit beta OS=Bos taurus OX=9913 GN=IL12B PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00041 fn3	7.4e-05	34.3	Fibronectin type III domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000221847

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000349365	0.998	Interleukin-27 subunit alpha
2	9606.ENSP00000303231	0.987	Interleukin-12 subunit alpha
3	9606.ENSP00000263379	0.979	Interleukin-27 receptor subunit alpha
4	9606.ENSP00000354394	0.931	Signal transducer and activator of transcription 1-alpha/beta
5	9606.ENSP00000370698	0.925	Interleukin-6 receptor subunit beta
6	9606.ENSP00000264657	0.922	Signal transducer and activator of transcription 3
7	9606.ENSP00000376134	0.912	Signal transducer and activator of transcription 4
8	9606.ENSP00000341208	0.910	Signal transducer and activator of transcription 5A
9	9606.ENSP00000343204	0.909	Tyrosine-protein kinase JAK1
10	9606.ENSP00000371067	0.909	Tyrosine-protein kinase JAK2
11	9606.ENSP00000431885	0.905	Non-receptor tyrosine-protein kinase TYK2
12	9606.ENSP00000315768	0.900	Signal transducer and activator of transcription 2
13	9606.ENSP00000247461	0.847	Calnexin
14	9606.ENSP00000262345	0.731	Interleukin-12 receptor subunit beta-2
15	9606.ENSP00000318804	0.642	Cytokine receptor-like factor 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004896	0.996	cytokine receptor activity
GO:0005102	0.654	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0050896	0.990	response to stimulus
GO:0048522	0.989	positive regulation of cellular process
GO:0002376	0.988	immune system process
GO:0042127	0.983	regulation of cell population proliferation
GO:0060255	0.980	regulation of macromolecule metabolic process
GO:0051239	0.976	regulation of multicellular organismal process
GO:0051240	0.972	positive regulation of multicellular organismal process
GO:0008284	0.964	positive regulation of cell population proliferation
GO:0001817	0.943	regulation of cytokine production
GO:0022407	0.938	regulation of cell-cell adhesion
GO:0050863	0.936	regulation of T cell activation
GO:0051251	0.936	positive regulation of lymphocyte activation
GO:0050670	0.935	regulation of lymphocyte proliferation
GO:0010604	0.932	positive regulation of macromolecule metabolic process
GO:0032649	0.932	regulation of type II interferon production
GO:0046634	0.932	regulation of alpha-beta T cell activation
GO:0032946	0.930	positive regulation of mononuclear cell proliferation
GO:1903039	0.927	positive regulation of leukocyte cell-cell adhesion
GO:0009987	0.914	cellular process
GO:0042129	0.907	regulation of T cell proliferation
GO:0050870	0.907	positive regulation of T cell activation
GO:0050671	0.859	positive regulation of lymphocyte proliferation
GO:0001819	0.834	positive regulation of cytokine production
GO:0006955	0.807	immune response
GO:0042102	0.743	positive regulation of T cell proliferation
GO:0032729	0.740	positive regulation of type II interferon production
GO:0046640	0.705	regulation of alpha-beta T cell proliferation
GO:0051716	0.669	cellular response to stimulus
GO:0046635	0.663	positive regulation of alpha-beta T cell activation
GO:0048583	0.660	regulation of response to stimulus
GO:0048519	0.503	negative regulation of biological process
GO:0023052	0.485	signaling
GO:0007154	0.485	cell communication
GO:0042221	0.456	response to chemical
GO:0007165	0.451	signal transduction
GO:0007166	0.438	cell surface receptor signaling pathway
GO:0010033	0.410	response to organic substance
GO:0032501	0.397	multicellular organismal process
GO:0048523	0.381	negative regulation of cellular process
GO:0050793	0.359	regulation of developmental process
GO:0006950	0.316	response to stress
GO:0048584	0.315	positive regulation of response to stimulus
GO:0009605	0.312	response to external stimulus
GO:0070887	0.308	cellular response to chemical stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.998	extracellular region
GO:0005737	0.998	cytoplasm
GO:0005886	0.998	plasma membrane
GO:0031974	0.997	membrane-enclosed lumen
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0070013	0.994	intracellular organelle lumen
GO:0012505	0.993	endomembrane system
GO:0005615	0.980	extracellular space
GO:0005783	0.904	endoplasmic reticulum
GO:0005788	0.778	endoplasmic reticulum lumen
GO:0005829	0.751	cytosol
GO:0031981	0.473	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]