StarFunc result for job id Q14232

User Input

>input (305 residues)
MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVD
SSVAVSSGGELFLRFISLASLEYSDYSKCKKIMIERGELFLRRISLSRNKIADLCHTFIK
DGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLD
AAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFP
LNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDEL
IKLYL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14232	1.000	1.000	7.815E-58	305	1.000	1.000	Q14232.pdb.gz	EI2BA_HUMAN Translation initiation factor eIF-2B subunit alpha OS=Homo sapiens OX=9606 GN=EIF2B1 PE=1 SV=1
2	PDB:3ecsC	0.902	0.935	1.215E-46	294	0.957	0.993	3ecsC.pdb.gz	Crystal structure of the alpha subunit of human translation initiation factor 2B
3	PDB:7kmaB	0.828	0.940	1.324E-42	268	0.859	0.978	7kmaB.pdb.gz	Sugar phosphate activation of the stress sensor eIF2B.
4	AFDB:Q9VAD4	0.931	0.928	8.253E-38	306	0.492	0.490	Q9VAD4.pdb.gz	Q9VAD4_DROME eIF-2B GDP-GTP exchange factor subunit alpha OS=Drosophila melanogaster OX=7227 GN=eIF2Balpha PE=1 SV=1
5	AFDB:P34604	0.966	0.966	7.139E-36	305	0.423	0.423	P34604.pdb.gz	EI2BA_CAEEL Probable translation initiation factor eIF-2B subunit alpha OS=Caenorhabditis elegans OX=6239 GN=ZK1098.4 PE=1 SV=1
6	AFDB:A0A1P8AVS2	0.884	0.665	1.383E-33	409	0.436	0.325	A0A1P8AVS2.pdb.gz	A0A1P8AVS2_ARATH eIF-2B GDP-GTP exchange factor subunit alpha OS=Arabidopsis thaliana OX=3702 GN=At1g72340 PE=1 SV=1
7	AFDB:Q9USP0	0.881	0.791	3.870E-32	341	0.423	0.378	Q9USP0.pdb.gz	EI2BA_SCHPO Translation initiation factor eIF-2B subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tif221 PE=1 SV=1
8	AFDB:P14741	0.865	0.865	4.876E-30	305	0.420	0.420	P14741.pdb.gz	EI2BA_YEAST Translation initiation factor eIF-2B subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GCN3 PE=1 SV=1
9	PDB:5b04B	0.873	0.836	1.010E-29	319	0.423	0.404	5b04B.pdb.gz
10	PDB:6i3mA	0.843	0.843	4.029E-24	305	0.413	0.413	6i3mA.pdb.gz	The structural basis of translational control by eIF2 phosphorylation.
11	AFDB:P49770	0.806	0.706	2.202E-22	351	0.256	0.222	P49770.pdb.gz	EI2BB_HUMAN Translation initiation factor eIF-2B subunit beta OS=Homo sapiens OX=9606 GN=EIF2B2 PE=1 SV=3
12	PDB:7l7gF	0.753	0.650	8.235E-22	357	0.223	0.190	7l7gF.pdb.gz	eIF2B conformation and assembly state regulates the integrated stress response.
13	AFDB:B3H7H1	0.771	0.584	1.046E-21	409	0.289	0.215	B3H7H1.pdb.gz	B3H7H1_ARATH AT3G07300 protein OS=Arabidopsis thaliana OX=3702 GN=At3g07300 PE=1 SV=1
14	AFDB:Q63186	0.751	0.452	1.104E-21	524	0.243	0.141	Q63186.pdb.gz	EI2BD_RAT Translation initiation factor eIF-2B subunit delta OS=Rattus norvegicus OX=10116 GN=Eif2b4 PE=2 SV=1
15	PDB:7f66C	0.799	0.732	1.137E-21	335	0.272	0.248	7f66C.pdb.gz
16	AFDB:Q9UI10	0.743	0.449	2.220E-21	523	0.226	0.132	Q9UI10.pdb.gz	EI2BD_HUMAN Translation initiation factor eIF-2B subunit delta OS=Homo sapiens OX=9606 GN=EIF2B4 PE=1 SV=2
17	PDB:5b04C	0.758	0.669	1.511E-19	349	0.236	0.206	5b04C.pdb.gz
18	PDB:6ezoD	0.761	0.754	1.444E-18	308	0.239	0.237	6ezoD.pdb.gz	Binding of ISRIB reveals a regulatory site in the nucleotide exchange factor eIF2B.
19	PDB:6jlyG	0.743	0.631	1.993E-18	363	0.233	0.196	6jlyG.pdb.gz	Structural basis for eIF2B inhibition in integrated stress response.
20	PDB:6i3mC	0.720	0.649	9.471E-18	342	0.243	0.216	6i3mC.pdb.gz	The structural basis of translational control by eIF2 phosphorylation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14232	0.0	625	305	1.000	1.000	EI2BA_HUMAN Translation initiation factor eIF-2B subunit alpha OS=Homo sapiens OX=9606 GN=EIF2B1 PE=1 SV=1
2	Q64270	0.0	582	305	0.928	0.928	EI2BA_RAT Translation initiation factor eIF-2B subunit alpha OS=Rattus norvegicus OX=10116 GN=Eif2b1 PE=2 SV=1
3	Q99LC8	0.0	590	305	0.941	0.941	EI2BA_MOUSE Translation initiation factor eIF-2B subunit alpha OS=Mus musculus OX=10090 GN=Eif2b1 PE=1 SV=1
4	Q9GQ89	5.50e-98	292	300	0.498	0.507	Q9GQ89_DROME eIF-2B GDP-GTP exchange factor subunit alpha OS=Drosophila melanogaster OX=7227 GN=eIF2Balpha PE=2 SV=1
5	Q9VAD4	6.48e-98	292	306	0.498	0.497	Q9VAD4_DROME eIF-2B GDP-GTP exchange factor subunit alpha OS=Drosophila melanogaster OX=7227 GN=eIF2Balpha PE=1 SV=1
6	P34604	1.42e-81	250	305	0.426	0.426	EI2BA_CAEEL Probable translation initiation factor eIF-2B subunit alpha OS=Caenorhabditis elegans OX=6239 GN=ZK1098.4 PE=1 SV=1
7	Q9USP0	1.33e-73	231	341	0.423	0.378	EI2BA_SCHPO Translation initiation factor eIF-2B subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tif221 PE=1 SV=1
8	P14741	1.84e-73	230	305	0.426	0.426	EI2BA_YEAST Translation initiation factor eIF-2B subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GCN3 PE=1 SV=1
9	A0A1P8AVS2	2.76e-71	228	409	0.452	0.337	A0A1P8AVS2_ARATH eIF-2B GDP-GTP exchange factor subunit alpha OS=Arabidopsis thaliana OX=3702 GN=At1g72340 PE=1 SV=1
10	B3H7H1	3.08e-27	111	409	0.236	0.176	B3H7H1_ARATH AT3G07300 protein OS=Arabidopsis thaliana OX=3702 GN=At3g07300 PE=1 SV=1
11	Q585B9	7.58e-27	108	299	0.223	0.227	Q585B9_TRYB2 Translation initiation factor eIF-2B alpha subunit, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.3A7.830 PE=3 SV=1
12	Q63186	9.88e-26	108	524	0.213	0.124	EI2BD_RAT Translation initiation factor eIF-2B subunit delta OS=Rattus norvegicus OX=10116 GN=Eif2b4 PE=2 SV=1
13	Q9UI10	1.29e-24	105	523	0.207	0.120	EI2BD_HUMAN Translation initiation factor eIF-2B subunit delta OS=Homo sapiens OX=9606 GN=EIF2B4 PE=1 SV=2
14	P49770	4.09e-21	94.0	351	0.230	0.199	EI2BB_HUMAN Translation initiation factor eIF-2B subunit beta OS=Homo sapiens OX=9606 GN=EIF2B2 PE=1 SV=3
15	Q53XC2	4.09e-21	94.0	351	0.230	0.199	Q53XC2_HUMAN Eukaryotic translation initiation factor 2B, subunit 2 beta, 39kDa OS=Homo sapiens OX=9606 GN=EIF2B2 PE=1 SV=1
16	Q9BPX4	4.35e-21	94.0	351	0.230	0.199	Q9BPX4_HUMAN Eukaryotic translation initiation factor 2B, subunit 2 beta, 39kDa OS=Homo sapiens OX=9606 GN=EIF2B2 PE=1 SV=1
17	Q62818	5.79e-20	90.9	351	0.230	0.199	EI2BB_RAT Translation initiation factor eIF-2B subunit beta OS=Rattus norvegicus OX=10116 GN=Eif2b2 PE=2 SV=1
18	Q09924	5.99e-18	85.9	467	0.220	0.143	EI2BD_SCHPO Probable translation initiation factor eIF-2B subunit delta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tif224 PE=1 SV=1
19	O76863	2.88e-16	80.5	352	0.187	0.162	O76863_DROME EG:100G10.3 protein OS=Drosophila melanogaster OX=7227 GN=eIF2Bbeta PE=1 SV=1
20	Q9UT76	2.56e-14	75.1	393	0.177	0.137	EI2BB_SCHPO Probable translation initiation factor eIF-2B subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tif222 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01008 IF-2B	1.6e-78	275.4	Initiation factor 2 subunit family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000002196

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000000790	0.999	Eukaryotic translation initiation factor 2, subunit 1 alpha, 35kDa
2	61853.ENSNLEP00000007422	0.999	Eukaryotic translation initiation factor 2B, subunit 5 epsilon, 82kDa
3	61853.ENSNLEP00000017293	0.999	Eukaryotic translation initiation factor 2B, subunit 3 gamma, 58kDa
4	61853.ENSNLEP00000019907	0.999	Eukaryotic translation initiation factor 2B, subunit 2 beta, 39kDa
5	61853.ENSNLEP00000004086	0.997	Eukaryotic translation initiation factor 2B, subunit 4 delta, 67kDa
6	61853.ENSNLEP00000022410	0.988	Uncharacterized protein
7	61853.ENSNLEP00000012234	0.985	Eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa
8	61853.ENSNLEP00000012240	0.946	Uncharacterized protein
9	61853.ENSNLEP00000002959	0.790	Eukaryotic translation initiation factor 2 alpha kinase 4
10	61853.ENSNLEP00000021487	0.770	Proteasome subunit alpha type
11	61853.ENSNLEP00000019545	0.764	Eukaryotic translation initiation factor 5
12	61853.ENSNLEP00000008404	0.723	GDP-mannose pyrophosphorylase B
13	61853.ENSNLEP00000001273	0.705	Eukaryotic translation initiation factor 2-alpha kinase 1
14	61853.ENSNLEP00000011057	0.676	RAB6A GEF complex partner 1
15	61853.ENSNLEP00000000337	0.655	GCN1, eIF2 alpha kinase activator homolog
16	61853.ENSNLEP00000011560	0.635	GDP-mannose pyrophosphorylase A
17	61853.ENSNLEP00000023391	0.610	Eukaryotic elongation factor, selenocysteine-tRNA-specific
18	61853.ENSNLEP00000008821	0.576	Actin-related protein 8
19	61853.ENSNLEP00000020191	0.573	Tyrosine--tRNA ligase
20	61853.ENSNLEP00000003961	0.570	Eukaryotic translation initiation factor 2A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0005085	0.999	guanyl-nucleotide exchange factor activity
GO:0003743	0.999	translation initiation factor activity
GO:0042802	0.739	identical protein binding
GO:0003824	0.352	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0008152	0.995	metabolic process
GO:0071704	0.993	organic substance metabolic process
GO:0044237	0.992	cellular metabolic process
GO:0065007	0.989	biological regulation
GO:0044238	0.987	primary metabolic process
GO:0006807	0.975	nitrogen compound metabolic process
GO:0006413	0.962	translational initiation
GO:0050789	0.895	regulation of biological process
GO:0050896	0.894	response to stimulus
GO:0050794	0.894	regulation of cellular process
GO:0006950	0.826	response to stress
GO:0048518	0.669	positive regulation of biological process
GO:0009628	0.371	response to abiotic stimulus
GO:0051716	0.311	cellular response to stimulus
GO:0009266	0.304	response to temperature stimulus
GO:0007154	0.303	cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005851	1.000	eukaryotic translation initiation factor 2B complex
GO:0016020	0.991	membrane
GO:0005829	0.991	cytosol
GO:0005886	0.955	plasma membrane
GO:0043226	0.812	organelle
GO:0043229	0.742	intracellular organelle
GO:0043227	0.648	membrane-bounded organelle
GO:0043231	0.618	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]