StarFunc result for job id Q14241

User Input

>input (798 residues)
MHGGRSCGPRTRREPSSGEEAAPVTAMAAESALQVVEKLQARLAANPDPKKLLKYLKKLS
TLPITVDILAETGVGKTVNSLRKHEHVGSFARDLVAQWKKLVPVERNAEPDEQDFEKSNS
RKRPRDALQKEEEMEGDYQETWKATGSRSYSPDHRQKKHRKLSELERPHKVSHGHERRDE
RKRCHRMSPTYSSDPESSDYGHVQSPPSCTSPHQMYVDHYRSLEEDQEPIVSHQKPGKGH
SNAFQDRLGASQERHLGEPHGKGVVSQNKEHKSSHKDKRPVDAKSDEKASVVSREKSHKA
LSKEENRRPPSGDNAREKPPSSGVKKEKDREGSSLKKKCLPPSEAASDNHLKKPKHRDPE
KAKLDKSKQGLDSFDTGKGAGDLLPKVKEKGSNNLKTPEGKVKTNLDRKSLGSLPKVEET
DMEDEFEQPTMSFESYLSYDQPRKKKKKIVKTSATALGDKGLKKNDSKSTGKNLDSVQKL
PKVNKTKSEKPAGADLAKLRKVPDVLPVLPDLPLPAIQANYRPLPSLELISSFQPKRKAF
SSPQEEEEAGFTGRRMNSKMQVYSGSKCAYLPKMMTLHQQCIRVLKNNIDSIFEVGGVPY
SVLEPVLERCTPDQLYRIEEYNHVLIEETDQLWKVHCHRDFKEERPEEYESWREMYLRLQ
DAREQRLRVLTKNIQFAHANKPKGRQAKMAFVNSVAKPPRDVRRRQEKFGTGGAAVPEKI
KIKPAPYPMGSSHASASSISFNPSPEEPAYDGPSTSSAHLAPVVSSTVSYDPRKPTVKKI
APMMAKTIKAFKNRFSRR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14241	1.000	1.000	2.444E-101	798	1.000	1.000	Q14241.pdb.gz	ELOA1_HUMAN Elongin-A OS=Homo sapiens OX=9606 GN=ELOA PE=1 SV=2
2	AFDB:Q63187	0.330	0.339	3.463E-81	773	0.806	0.832	Q63187.pdb.gz	ELOA1_RAT Elongin-A OS=Rattus norvegicus OX=10116 GN=Eloa PE=1 SV=1
3	AFDB:Q8IYF1	0.159	0.168	9.642E-42	753	0.455	0.482	Q8IYF1.pdb.gz	ELOA2_HUMAN Elongin-A2 OS=Homo sapiens OX=9606 GN=ELOA2 PE=1 SV=2
4	AFDB:O95402	0.090	0.115	4.409E-3	600	0.135	0.180	O95402.pdb.gz	MED26_HUMAN Mediator of RNA polymerase II transcription subunit 26 OS=Homo sapiens OX=9606 GN=MED26 PE=1 SV=2
5	AFDB:Q86AD8	0.055	0.041	4.409E-3	1207	0.105	0.070	Q86AD8.pdb.gz	Q86AD8_DICDI RING zinc finger-containing protein OS=Dictyostelium discoideum OX=44689 GN=DG1106 PE=4 SV=1
6	AFDB:C8V1V6	0.064	0.058	4.936E-3	904	0.170	0.150	C8V1V6.pdb.gz	C8V1V6_EMENI Uncharacterized protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_10853 PE=4 SV=1
7	AFDB:Q70HU3	0.084	0.060	4.936E-3	1135	0.174	0.122	Q70HU3.pdb.gz	Q70HU3_DROME PNUTSDm protein OS=Drosophila melanogaster OX=7227 GN=PNUTS PE=2 SV=1
8	AFDB:Q9BYV9	0.048	0.047	8.681E-3	841	0.127	0.120	Q9BYV9.pdb.gz	BACH2_HUMAN Transcription regulator protein BACH2 OS=Homo sapiens OX=9606 GN=BACH2 PE=1 SV=1
9	AFDB:Q9VUQ9	0.070	0.038	9.185E-3	2139	0.138	0.051	Q9VUQ9.pdb.gz	Q9VUQ9_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=dop PE=1 SV=1
10	AFDB:A0A2R8RUQ1	0.053	0.052	1.218E-2	828	0.132	0.127	A0A2R8RUQ1.pdb.gz
11	PDB:3euhC	0.039	0.098	1.334	206	0.025	0.097	3euhC.pdb.gz
12	PDB:7ajtUO	0.084	0.123	1.493	493	0.024	0.039	7ajtUO.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
13	PDB:6vvoE	0.065	0.132	1.672	346	0.019	0.043	6vvoE.pdb.gz	Structure of the human clamp loader bound to the sliding clamp: a further twist on AAA+ mechanism
14	PDB:7qskV	0.042	0.208	1.769	115	0.026	0.183	7qskV.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
15	PDB:6zheC	0.049	0.053	2.482	705	0.024	0.027	6zheC.pdb.gz	Dimers of DNA-PK create a stage for DNA double-strand break repair.
16	PDB:7ky1A	0.042	0.119	2.626	189	0.014	0.058	7ky1A.pdb.gz
17	PDB:3iqcA	0.060	0.226	3.111	119	0.021	0.143	3iqcA.pdb.gz
18	PDB:4cabA	0.053	0.076	3.111	507	0.024	0.037	4cabA.pdb.gz	Structure of the Mono-Functional Heme Catalase Dr1998 from Deinococcus Radiodurans
19	PDB:7x3kA	0.040	0.100	3.685	262	0.016	0.050	7x3kA.pdb.gz
20	PDB:7sn8D	0.045	0.074	3.899	399	0.013	0.025	7sn8D.pdb.gz	Inositol hexakisphosphate is required for Integrator function.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14241	0.0	1637	798	1.000	1.000	ELOA1_HUMAN Elongin-A OS=Homo sapiens OX=9606 GN=ELOA PE=1 SV=2
2	Q63187	0.0	1212	773	0.807	0.833	ELOA1_RAT Elongin-A OS=Rattus norvegicus OX=10116 GN=Eloa PE=1 SV=1
3	Q8IYF1	0.0	579	753	0.469	0.497	ELOA2_HUMAN Elongin-A2 OS=Homo sapiens OX=9606 GN=ELOA2 PE=1 SV=2
4	Q9VCP0	3.19e-43	169	643	0.125	0.156	ELOA1_DROME Transcription elongation factor B polypeptide 3 OS=Drosophila melanogaster OX=7227 GN=EloA PE=1 SV=1
5	Q09413	4.47e-13	74.3	434	0.061	0.113	ELOA1_CAEEL Transcription elongation factor B polypeptide 3 OS=Caenorhabditis elegans OX=6239 GN=tceb-3 PE=1 SV=1
6	O59671	4.87e-10	63.2	263	0.043	0.129	ELOA1_SCHPO Elongin-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pof4 PE=1 SV=3
7	P10711	1.19e-05	50.4	301	0.029	0.076	TCEA1_MOUSE Transcription elongation factor A protein 1 OS=Mus musculus OX=10090 GN=Tcea1 PE=1 SV=2
8	A0A1W2PPZ5	1.97e-05	49.7	301	0.028	0.073	A0A1W2PPZ5_HUMAN Transcription elongation factor (Fragment) OS=Homo sapiens OX=9606 GN=TCEA1 PE=1 SV=1
9	A0A384MTX4	1.98e-05	49.7	301	0.028	0.073	A0A384MTX4_HUMAN Transcription elongation factor OS=Homo sapiens OX=9606 PE=2 SV=1
10	P23193	1.98e-05	49.7	301	0.028	0.073	TCEA1_HUMAN Transcription elongation factor A protein 1 OS=Homo sapiens OX=9606 GN=TCEA1 PE=1 SV=2
11	Q4KLL0	2.11e-05	49.7	301	0.028	0.073	TCEA1_RAT Transcription elongation factor A protein 1 OS=Rattus norvegicus OX=10116 GN=Tcea1 PE=1 SV=1
12	Q9ZVH8	4.16e-05	48.9	378	0.033	0.069	RDO2_ARATH Transcription elongation factor TFIIS OS=Arabidopsis thaliana OX=3702 GN=TFIIS PE=1 SV=1
13	P53861	5.05e-05	48.9	379	0.033	0.069	ELOA1_YEAST Elongin-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ELA1 PE=1 SV=1
14	Q15560	1.08e-04	47.4	299	0.028	0.074	TCEA2_HUMAN Transcription elongation factor A protein 2 OS=Homo sapiens OX=9606 GN=TCEA2 PE=1 SV=1
15	Q6IB64	1.08e-04	47.4	299	0.028	0.074	Q6IB64_HUMAN Transcription elongation factor OS=Homo sapiens OX=9606 GN=TCEA2 PE=2 SV=1
16	Q63799	1.45e-04	47.0	299	0.030	0.080	TCEA2_RAT Transcription elongation factor A protein 2 OS=Rattus norvegicus OX=10116 GN=Tcea2 PE=2 SV=1
17	O75764	1.84e-04	47.0	348	0.031	0.072	TCEA3_HUMAN Transcription elongation factor A protein 3 OS=Homo sapiens OX=9606 GN=TCEA3 PE=1 SV=2
18	Q86VL0	3.46e-04	45.4	242	0.028	0.091	Q86VL0_HUMAN TCEA2 protein OS=Homo sapiens OX=9606 GN=TCEA2 PE=1 SV=1
19	P23881	5.47e-04	45.4	347	0.030	0.069	TCEA3_MOUSE Transcription elongation factor A protein 3 OS=Mus musculus OX=10090 GN=Tcea3 PE=1 SV=3
20	F4JCS8	0.003	43.9	1613	0.028	0.014	F4JCS8_ARATH Protein SUO OS=Arabidopsis thaliana OX=3702 GN=SUO PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06881 Elongin_A	1.7e-22	91.3	RNA polymerase II transcription factor SIII (Elongin) subunit A
2	PF08711 Med26	2.1e-09	48.6	TFIIS helical bundle-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000395574

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000478121	0.999	Elongin-C
2	9606.ENSP00000262306	0.997	Elongin-B
3	9606.ENSP00000376808	0.972	Cullin-5
4	9606.ENSP00000299601	0.924	RNA polymerase-associated protein LEO1
5	9606.ENSP00000331302	0.906	Elongin-A2
6	9606.ENSP00000328232	0.904	Elongin-A3
7	9606.ENSP00000483981	0.900	Elongin-A3 member D
8	9606.ENSP00000355013	0.895	RNA polymerase-associated protein CTR9 homolog
9	9606.ENSP00000480158	0.894	DNA-directed RNA polymerase II subunit RPB1
10	9606.ENSP00000295321	0.820	Protein IWS1 homolog
11	9606.ENSP00000359345	0.819	60S ribosomal protein L5
12	9606.ENSP00000170168	0.802	RNA exonuclease 1 homolog
13	9606.ENSP00000419117	0.796	60S ribosomal protein L35a
14	9606.ENSP00000467466	0.794	Ribosomal protein S15
15	9606.ENSP00000346046	0.783	Ribosomal protein S17
16	9606.ENSP00000340823	0.779	General transcription factor IIF subunit 2
17	9606.ENSP00000296674	0.777	40S ribosomal protein S23
18	9606.ENSP00000414321	0.776	40S ribosomal protein S24
19	9606.ENSP00000464342	0.774	60S ribosomal protein L36
20	9606.ENSP00000377969	0.772	General transcription factor IIF subunit 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.628	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:0044237	0.998	cellular metabolic process
GO:0006807	0.997	nitrogen compound metabolic process
GO:0043170	0.997	macromolecule metabolic process
GO:0050789	0.995	regulation of biological process
GO:0010467	0.990	gene expression
GO:0009059	0.990	macromolecule biosynthetic process
GO:0044271	0.990	cellular nitrogen compound biosynthetic process
GO:0050794	0.989	regulation of cellular process
GO:0010468	0.956	regulation of gene expression
GO:0051252	0.953	regulation of RNA metabolic process
GO:0010556	0.952	regulation of macromolecule biosynthetic process
GO:0031326	0.952	regulation of cellular biosynthetic process
GO:0006355	0.939	regulation of DNA-templated transcription
GO:0006357	0.931	regulation of transcription by RNA polymerase II
GO:0016070	0.929	RNA metabolic process
GO:0006366	0.916	transcription by RNA polymerase II
GO:0006354	0.339	DNA-templated transcription elongation
GO:0006368	0.316	transcription elongation by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008023	0.998	transcription elongation factor complex
GO:0043232	0.973	intracellular non-membrane-bounded organelle
GO:0005576	0.968	extracellular region
GO:0005615	0.919	extracellular space
GO:0005829	0.804	cytosol
GO:0070449	0.474	elongin complex
GO:0005694	0.372	chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]