StarFunc result for job id Q14247

User Input

>input (550 residues)
MWKASAGHAVSIAQDDAGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRE
NVFQEHQTLKEKELETGPKASHGYGGKFGVEQDRMDKSAVGHEYQSKLSKHCSQVDSVRG
FGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQG
KTEKHESQRDYSKGFGGKYGIDKDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQT
DRQDKCALGWDHQEKLQLHESQKDYKTGFGGKFGVQSERQDSAAVGFDYKEKLAKHESQQ
DYSKGFGGKYGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKE
KEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPV
YEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREASSQQGLAYATEAVYESAEAPGHYP
AEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGL
FPANYVELRQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14247	1.000	1.000	1.592E-83	550	1.000	1.000	Q14247.pdb.gz	SRC8_HUMAN Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN PE=1 SV=2
2	AFDB:Q01406	0.160	0.157	2.209E-65	563	0.853	0.833	Q01406.pdb.gz	SRC8_CHICK Src substrate protein p85 OS=Gallus gallus OX=9031 GN=CTTN1 PE=1 SV=1
3	AFDB:Q66HL2	0.167	0.178	2.355E-63	509	0.851	0.919	Q66HL2.pdb.gz	SRC8_RAT Src substrate cortactin OS=Rattus norvegicus OX=10116 GN=Cttn PE=1 SV=1
4	AFDB:A1Z7A6	0.110	0.055	9.752E-7	1155	0.131	0.062	A1Z7A6.pdb.gz	ASAP_DROME ArfGAP with SH3 domain, ANK repeat and PH domain-containing protein OS=Drosophila melanogaster OX=7227 GN=Asap PE=1 SV=1
5	PDB:3ehqA	0.098	0.285	2.705E-6	182	0.042	0.126	3ehqA.pdb.gz
6	AFDB:Q12965	0.112	0.060	1.252E-5	1108	0.073	0.036	Q12965.pdb.gz	MYO1E_HUMAN Unconventional myosin-Ie OS=Homo sapiens OX=9606 GN=MYO1E PE=1 SV=2
7	PDB:2dybA	0.104	0.190	2.111E-5	298	0.029	0.054	2dybA.pdb.gz
8	PDB:1k9aB	0.101	0.126	2.881E-5	441	0.033	0.041	1k9aB.pdb.gz
9	PDB:1griA	0.101	0.258	3.264E-5	211	0.036	0.095	1griA.pdb.gz
10	AFDB:Q9JIR0	0.101	0.033	1.419E-4	1847	0.145	0.043	Q9JIR0.pdb.gz	RIMB1_RAT Peripheral-type benzodiazepine receptor-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Tspoap1 PE=1 SV=2
11	PDB:2lqnA	0.102	0.180	1.547E-4	303	0.040	0.073	2lqnA.pdb.gz
12	PDB:6x5hA	0.095	0.112	1.865E-4	467	0.036	0.043	6x5hA.pdb.gz	Characterizing human alpha-1,6-fucosyltransferase (FUT8) substrate specificity and structural similarities with related fucosyltransferases.
13	AFDB:Q9BX66	0.107	0.047	2.336E-4	1292	0.116	0.050	Q9BX66.pdb.gz	SRBS1_HUMAN Sorbin and SH3 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SORBS1 PE=1 SV=3
14	PDB:3qwyA	0.105	0.323	2.884E-4	170	0.024	0.076	3qwyA.pdb.gz
15	PDB:1k0xA	0.098	0.455	3.266E-4	108	0.029	0.148	1k0xA.pdb.gz
16	PDB:4mt6A	0.092	0.129	5.051E-4	389	0.029	0.041	4mt6A.pdb.gz
17	PDB:2h8hA	0.091	0.113	8.311E-4	445	0.029	0.036	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
18	AFDB:G5ECK4	0.099	0.038	2.338E-3	1523	0.120	0.043	G5ECK4.pdb.gz	G5ECK4_CAEEL SH3 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dnbp-1 PE=1 SV=1
19	AFDB:A0A494C1M0	0.104	0.058	4.935E-3	1011	0.120	0.065	A0A494C1M0.pdb.gz	A0A494C1M0_HUMAN SH3 domain containing 19 OS=Homo sapiens OX=9606 GN=SH3D19 PE=1 SV=1
20	AFDB:Q67Y69	0.105	0.118	5.252E-3	478	0.136	0.157	Q67Y69.pdb.gz	WDL7_ARATH Protein WVD2-like 7 OS=Arabidopsis thaliana OX=3702 GN=WDL7 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q01406	0.0	944	563	0.853	0.833	SRC8_CHICK Src substrate protein p85 OS=Gallus gallus OX=9031 GN=CTTN1 PE=1 SV=1
2	Q14247	0.0	1129	550	1.000	1.000	SRC8_HUMAN Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN PE=1 SV=2
3	Q1RMR3	0.0	991	538	0.885	0.905	Q1RMR3_BOVIN Cortactin OS=Bos taurus OX=9913 GN=CTTN PE=1 SV=1
4	Q60598	0.0	1041	546	0.922	0.929	SRC8_MOUSE Src substrate cortactin OS=Mus musculus OX=10090 GN=Cttn PE=1 SV=2
5	Q66HL2	0.0	914	509	0.844	0.912	SRC8_RAT Src substrate cortactin OS=Rattus norvegicus OX=10116 GN=Cttn PE=1 SV=1
6	O96046	1.60e-124	378	559	0.451	0.444	O96046_DROME Cortactin OS=Drosophila melanogaster OX=7227 GN=Cortactin PE=2 SV=1
7	Q9VDF4	1.48e-122	373	559	0.442	0.435	Q9VDF4_DROME Cortactin, isoform A OS=Drosophila melanogaster OX=7227 GN=Cortactin PE=1 SV=1
8	P49710	1.83e-106	329	486	0.276	0.313	HCLS1_MOUSE Hematopoietic lineage cell-specific protein OS=Mus musculus OX=10090 GN=Hcls1 PE=1 SV=2
9	P14317	4.91e-105	326	486	0.269	0.305	HCLS1_HUMAN Hematopoietic lineage cell-specific protein OS=Homo sapiens OX=9606 GN=HCLS1 PE=1 SV=3
10	E7EVW7	6.19e-84	270	449	0.220	0.269	E7EVW7_HUMAN Hematopoietic cell-specific Lyn substrate 1 OS=Homo sapiens OX=9606 GN=HCLS1 PE=1 SV=1
11	Q9JHL4	7.09e-21	97.4	436	0.116	0.147	DBNL_RAT Drebrin-like protein OS=Rattus norvegicus OX=10116 GN=Dbnl PE=1 SV=1
12	H0Y5J4	2.00e-19	92.4	359	0.124	0.189	H0Y5J4_HUMAN Drebrin like (Fragment) OS=Homo sapiens OX=9606 GN=DBNL PE=1 SV=1
13	H7C111	2.42e-19	86.7	138	0.069	0.275	H7C111_HUMAN Drebrin like (Fragment) OS=Homo sapiens OX=9606 GN=DBNL PE=1 SV=1
14	Q9UJU6	4.76e-19	92.0	430	0.124	0.158	DBNL_HUMAN Drebrin-like protein OS=Homo sapiens OX=9606 GN=DBNL PE=1 SV=1
15	B4DDD6	5.20e-19	91.7	406	0.124	0.167	B4DDD6_HUMAN Drebrin like OS=Homo sapiens OX=9606 GN=DBNL PE=1 SV=1
16	Q62418	7.26e-18	88.6	436	0.069	0.087	DBNL_MOUSE Drebrin-like protein OS=Mus musculus OX=10090 GN=Dbnl PE=1 SV=2
17	Q9VU84	6.66e-17	85.9	531	0.073	0.075	DBNL_DROME Drebrin-like protein OS=Drosophila melanogaster OX=7227 GN=Abp1 PE=1 SV=1
18	Q9P7E8	1.44e-12	72.8	857	0.053	0.034	APP1_SCHPO Protein app1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=app1 PE=2 SV=1
19	A9P3U3	7.75e-12	70.5	774	0.058	0.041	A9P3U3_EMEND AbpA OS=Emericella nidulans OX=162425 GN=abpA PE=4 SV=1
20	Q91X43	4.51e-10	64.7	789	0.049	0.034	SH319_MOUSE SH3 domain-containing protein 19 OS=Mus musculus OX=10090 GN=Sh3d19 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02218 HS1_rep	4.1e-125	419.1	Repeat in HS1/Cortactin
2	PF04678 MCU	8.2e+02	11.4	Mitochondrial calcium uniporter
3	PF00018 SH3_1	8.7e-13	59.0	SH3 domain
4	PF07653 SH3_2	8e-06	36.9	Variant SH3 domain
5	PF14604 SH3_9	5.3e-14	63.2	Variant SH3 domain
6	PF15195 TMEM210	0.0082	28.0	TMEM210 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003828816.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003812175.1	0.987	Huntingtin-interacting protein 1-related protein isoform X1
2	9597.XP_008956034.1	0.964	Paxillin
3	9597.XP_003830950.1	0.940	ATP-binding component of the Arp2/3 complex, a multiprotein complex that mediates actin polymerization upon stimulation by nucleation-promoting factor (NPF). The Arp2/3 complex mediates the formation of branched actin networks in the cytoplasm, providing the force for cell motility. Seems to contact the pointed end of the daughter actin filament
4	9597.XP_008955538.1	0.924	SRC proto-oncogene, non-receptor tyrosine kinase
5	9597.XP_003815516.1	0.918	Neural Wiskott-Aldrich syndrome protein
6	9597.XP_008950074.1	0.910	Catenin delta 1
7	9597.XP_008953720.1	0.891	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments
8	9597.XP_008972193.1	0.891	arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1
9	9597.XP_003810710.1	0.877	Potassium voltage-gated channel subfamily A member 2
10	9597.XP_008951697.1	0.868	Cell surface proteoglycan
11	9597.XP_008965537.1	0.867	Cadherins are calcium-dependent cell adhesion proteins.
12	9597.XP_008971120.1	0.865	Belongs to the protein kinase superfamily. Tyr protein kinase family
13	9597.XP_008961666.1	0.855	Belongs to the MAGUK family.
14	9597.XP_008954244.1	0.848	Dynamin-2
15	9597.XP_008960166.1	0.848	Belongs to the TRAFAC class dynamin-like GTPase superfamily. Dynamin/Fzo/YdjA family
16	9597.XP_003815698.1	0.840	YES proto-oncogene 1, Src family tyrosine kinase
17	9597.XP_003813044.1	0.839	Vinculin
18	9597.XP_003807266.1	0.838	Wiskott-Aldrich syndrome
19	9597.XP_008949747.1	0.837	Catenin beta 1
20	9597.XP_008974002.1	0.835	Tyrosine-protein kinase Fyn isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0045296	0.646	cadherin binding
GO:0005522	0.511	profilin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0009987	0.986	cellular process
GO:0051128	0.978	regulation of cellular component organization
GO:0048522	0.957	positive regulation of cellular process
GO:0033043	0.929	regulation of organelle organization
GO:0051130	0.900	positive regulation of cellular component organization
GO:0016043	0.886	cellular component organization
GO:0043254	0.884	regulation of protein-containing complex assembly
GO:1902903	0.796	regulation of supramolecular fiber organization
GO:0051179	0.784	localization
GO:0032970	0.779	regulation of actin filament-based process
GO:0051495	0.730	positive regulation of cytoskeleton organization
GO:0048870	0.729	cell motility
GO:0050793	0.706	regulation of developmental process
GO:0032271	0.677	regulation of protein polymerization
GO:0120036	0.661	plasma membrane bounded cell projection organization
GO:0065008	0.624	regulation of biological quality
GO:0034330	0.622	cell junction organization
GO:0046907	0.622	intracellular transport
GO:0050896	0.572	response to stimulus
GO:0015031	0.564	protein transport
GO:0007154	0.552	cell communication
GO:0006886	0.544	intracellular protein transport
GO:0023052	0.538	signaling
GO:1902905	0.494	positive regulation of supramolecular fiber organization
GO:0051716	0.486	cellular response to stimulus
GO:0007165	0.468	signal transduction
GO:0051094	0.430	positive regulation of developmental process
GO:0044089	0.427	positive regulation of cellular component biogenesis
GO:0032273	0.418	positive regulation of protein polymerization
GO:0007166	0.416	cell surface receptor signaling pathway
GO:0048583	0.387	regulation of response to stimulus
GO:0032501	0.368	multicellular organismal process
GO:0032956	0.367	regulation of actin cytoskeleton organization
GO:0032502	0.359	developmental process
GO:0048856	0.348	anatomical structure development
GO:0030833	0.329	regulation of actin filament polymerization
GO:0051239	0.312	regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005886	0.999	plasma membrane
GO:0012505	0.998	endomembrane system
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0032991	0.997	protein-containing complex
GO:0043232	0.995	intracellular non-membrane-bounded organelle
GO:0005829	0.989	cytosol
GO:0098797	0.988	plasma membrane protein complex
GO:0015629	0.988	actin cytoskeleton
GO:0120025	0.980	plasma membrane bounded cell projection
GO:0070161	0.979	anchoring junction
GO:0031252	0.975	cell leading edge
GO:0031982	0.947	vesicle
GO:0030055	0.941	cell-substrate junction
GO:0099080	0.928	supramolecular complex
GO:0005925	0.920	focal adhesion
GO:1990351	0.906	transporter complex
GO:0031410	0.896	cytoplasmic vesicle
GO:0034703	0.891	cation channel complex
GO:0034705	0.869	potassium channel complex
GO:0008076	0.827	voltage-gated potassium channel complex
GO:0005634	0.804	nucleus
GO:0045202	0.797	synapse
GO:0099512	0.695	supramolecular fiber
GO:0005938	0.692	cell cortex
GO:0099513	0.659	polymeric cytoskeletal fiber
GO:0030027	0.650	lamellipodium
GO:0005884	0.621	actin filament
GO:0043005	0.597	neuron projection
GO:0098794	0.437	postsynapse
GO:0030863	0.396	cortical cytoskeleton
GO:0098590	0.370	plasma membrane region
GO:0070013	0.349	intracellular organelle lumen
GO:0005794	0.303	Golgi apparatus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]