StarFunc result for job id Q14249

User Input

>input (297 residues)
MRALRAGLTLASGAGLGAVVEGWRRRREDARAAPGLLGRLPVLPVAAAAELPPVPGGPRG
PGELAKYGLPGLAQLKSRESYVLCYDPRTRGALWVVEQLRPERLRGDGDRRECDFREDDS
VHAYHRATNADYRGSGFDRGHLAAAANHRWSQKAMDDTFYLSNVAPQVPHLNQNAWNNLE
KYSRSLTRSYQNVYVCTGPLFLPRTEADGKSYVKYQVIGKNHVAVPTHFFKVLILEAAGG
QIELRTYVMPNAPVDEAIPLERFLVPIESIERASGLLFVPNILARAGSLKAITAGSK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P38447	0.895	0.889	4.278E-61	299	0.916	0.910	P38447.pdb.gz	NUCG_BOVIN Endonuclease G, mitochondrial OS=Bos taurus OX=9913 GN=ENDOG PE=1 SV=1
2	AFDB:Q3V5X8	0.872	0.881	6.413E-58	294	0.889	0.898	Q3V5X8.pdb.gz
3	AFDB:Q7JXB9	0.724	0.694	2.735E-37	310	0.502	0.481	Q7JXB9.pdb.gz	Q7JXB9_DROME Endonuclease OS=Drosophila melanogaster OX=7227 GN=EndoG PE=1 SV=1
4	AFDB:Q95NM6	0.724	0.698	1.318E-33	308	0.407	0.393	Q95NM6.pdb.gz	NUCG_CAEEL Endonuclease G, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=cps-6 PE=1 SV=1
5	AFDB:Q8C163	0.755	0.613	2.445E-31	368	0.350	0.283	Q8C163.pdb.gz	EXOG_MOUSE Nuclease EXOG, mitochondrial OS=Mus musculus OX=10090 GN=Exog PE=1 SV=1
6	AFDB:Q10480	0.737	0.681	1.367E-30	322	0.357	0.329	Q10480.pdb.gz	PNU1_SCHPO Nuclease 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pnu1 PE=2 SV=2
7	AFDB:Q9Y2C4	0.763	0.619	1.643E-30	368	0.347	0.280	Q9Y2C4.pdb.gz	EXOG_HUMAN Nuclease EXOG, mitochondrial OS=Homo sapiens OX=9606 GN=EXOG PE=1 SV=2
8	AFDB:P08466	0.742	0.672	4.131E-30	329	0.370	0.334	P08466.pdb.gz	NUC1_YEAST Mitochondrial nuclease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NUC1 PE=1 SV=1
9	AFDB:Q5BB95	0.742	0.662	1.328E-29	334	0.374	0.332	Q5BB95.pdb.gz	Q5BB95_EMENI Endonuclease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02185 PE=3 SV=1
10	AFDB:E2RUH0	0.592	0.217	2.456E-12	859	0.138	0.048	E2RUH0.pdb.gz	E2RUH0_CHICK Ectonucleotide pyrophosphatase/phosphodiesterase 2, long form OS=Gallus gallus OX=9031 GN=Enpp2 PE=2 SV=1
11	PDB:5s9mA	0.576	0.222	1.231E-11	809	0.155	0.057	5s9mA.pdb.gz	Crystal Structure of a rat Autotaxin complex
12	PDB:3wayA	0.553	0.220	1.780E-11	787	0.135	0.051	3wayA.pdb.gz	Screening and X-ray Crystal Structure-based Optimization of Autotaxin (ENPP2) Inhibitors, Using a Newly Developed Fluorescence Probe
13	PDB:6c01A	0.540	0.214	7.318E-11	819	0.178	0.065	6c01A.pdb.gz	Structural basis for nucleotide recognition by the ectoenzyme CD203c.
14	PDB:6g4gD	0.523	0.214	1.439E-10	781	0.158	0.060	6g4gD.pdb.gz	Crystallization of ectonucleotide phosphodiesterase/pyrophosphatase-3 and orientation of the SMB domains in the full-length ectodomain.
15	PDB:6g4gB	0.519	0.218	9.090E-10	759	0.168	0.066	6g4gB.pdb.gz	Crystallization of ectonucleotide phosphodiesterase/pyrophosphatase-3 and orientation of the SMB domains in the full-length ectodomain.
16	PDB:6wevAbA	0.524	0.207	1.314E-9	817	0.162	0.059	6wevAbA.pdb.gz	Crystal structures of human ENPP1 in apo and bound forms.
17	PDB:4b56A	0.465	0.181	1.787E-9	816	0.148	0.054	4b56A.pdb.gz	Structure of Npp1, an Ectonucleotide Pyrophosphatase/Phosphodiesterase Involved in Tissue Calcification.
18	PDB:6g4gC	0.454	0.194	2.361E-8	742	0.162	0.065	6g4gC.pdb.gz	Crystallization of ectonucleotide phosphodiesterase/pyrophosphatase-3 and orientation of the SMB domains in the full-length ectodomain.
19	PDB:6xkdB	0.491	0.227	3.630E-8	681	0.131	0.057	6xkdB.pdb.gz	Structure-Aided Development of Small-Molecule Inhibitors of ENPP1, the Extracellular Phosphodiesterase of the Immunotransmitter cGAMP.
20	PDB:5fguA	0.301	0.189	2.111E-2	494	0.088	0.053	5fguA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O08600	0.0	508	294	0.896	0.905	NUCG_MOUSE Endonuclease G, mitochondrial OS=Mus musculus OX=10090 GN=Endog PE=1 SV=1
2	P38447	0.0	503	299	0.912	0.906	NUCG_BOVIN Endonuclease G, mitochondrial OS=Bos taurus OX=9913 GN=ENDOG PE=1 SV=1
3	Q14249	0.0	605	297	1.000	1.000	NUCG_HUMAN Endonuclease G, mitochondrial OS=Homo sapiens OX=9606 GN=ENDOG PE=1 SV=4
4	Q7JXB9	6.79e-91	274	310	0.495	0.474	Q7JXB9_DROME Endonuclease OS=Drosophila melanogaster OX=7227 GN=EndoG PE=1 SV=1
5	Q95NM6	1.82e-77	240	308	0.370	0.357	NUCG_CAEEL Endonuclease G, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=cps-6 PE=1 SV=1
6	P08466	2.87e-56	186	329	0.327	0.295	NUC1_YEAST Mitochondrial nuclease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NUC1 PE=1 SV=1
7	Q9Y2C4	2.09e-54	182	368	0.313	0.253	EXOG_HUMAN Nuclease EXOG, mitochondrial OS=Homo sapiens OX=9606 GN=EXOG PE=1 SV=2
8	Q10480	2.73e-54	181	322	0.323	0.298	PNU1_SCHPO Nuclease 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pnu1 PE=2 SV=2
9	Q5BB95	5.94e-54	180	334	0.337	0.299	Q5BB95_EMENI Endonuclease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02185 PE=3 SV=1
10	Q8C163	1.06e-53	181	368	0.330	0.266	EXOG_MOUSE Nuclease EXOG, mitochondrial OS=Mus musculus OX=10090 GN=Exog PE=1 SV=1
11	H7C0W6	7.11e-38	134	187	0.222	0.353	H7C0W6_HUMAN Exo/endonuclease G (Fragment) OS=Homo sapiens OX=9606 GN=EXOG PE=1 SV=1
12	Q00688	0.15	35.4	224	0.084	0.112	FKBP3_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP3 OS=Homo sapiens OX=9606 GN=FKBP3 PE=1 SV=1
13	Q9VAU2	0.20	35.4	370	0.108	0.086	Q9VAU2_DROME IP21418p OS=Drosophila melanogaster OX=7227 GN=Sid PE=2 SV=1
14	Q62446	0.64	33.5	224	0.081	0.107	FKBP3_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP3 OS=Mus musculus OX=10090 GN=Fkbp3 PE=1 SV=2
15	B0JZL7	1.7	32.7	878	0.081	0.027	B0JZL7_DANRE Ectonucleotide pyrophosphatase/phosphodiesterase 1 OS=Danio rerio OX=7955 GN=si:ch211-142e24.2 PE=1 SV=1
16	O94919	1.8	32.7	500	0.084	0.050	ENDD1_HUMAN Endonuclease domain-containing 1 protein OS=Homo sapiens OX=9606 GN=ENDOD1 PE=1 SV=2
17	A0FGR8	5.1	31.2	921	0.061	0.020	ESYT2_HUMAN Extended synaptotagmin-2 OS=Homo sapiens OX=9606 GN=ESYT2 PE=1 SV=1
18	Q2XXU2	5.3	31.2	1505	0.061	0.012	Q2XXU2_DROME CG17766 (Fragment) OS=Drosophila melanogaster OX=7227 GN=Rbcn-3B PE=4 SV=1
19	Q9W543	5.3	31.2	1525	0.061	0.012	Q9W543_DROME Rabconnectin-3B, isoform A OS=Drosophila melanogaster OX=7227 GN=Rbcn-3B PE=1 SV=1
20	O46092	5.6	31.2	1471	0.061	0.012	O46092_DROME EG:86E4.3 protein OS=Drosophila melanogaster OX=7227 GN=Rbcn-3B PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01223 Endonuclease_NS	4.7e-59	211.5	DNA/RNA non-specific endonuclease

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361725

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000287295	0.963	Apoptosis-inducing factor 1, mitochondrial
2	9606.ENSP00000305480	0.959	Flap endonuclease 1
3	9606.ENSP00000307786	0.900	Cytochrome c
4	9606.ENSP00000258080	0.888	Serine protease HTRA2, mitochondrial
5	9606.ENSP00000357008	0.877	Intelectin-2
6	9606.ENSP00000398495	0.841	Diablo homolog, mitochondrial
7	9606.ENSP00000448165	0.800	Apoptotic protease-activating factor 1
8	9606.ENSP00000354812	0.795	Putative methyltransferase C9orf114
9	9606.ENSP00000399415	0.793	Kynurenine--oxoglutarate transaminase 1
10	9606.ENSP00000361731	0.770	TBC1 domain family member 13
11	9606.ENSP00000339524	0.750	DNA fragmentation factor subunit beta
12	9606.ENSP00000337445	0.749	Zinc phosphodiesterase ELAC protein 2
13	9606.ENSP00000330237	0.735	Caspase-9
14	9606.ENSP00000311032	0.721	Caspase-3
15	9606.ENSP00000351273	0.692	Caspase-8
16	9606.ENSP00000340578	0.678	Ras association domain-containing protein 6
17	9606.ENSP00000302961	0.677	Heat shock protein family A member 4
18	9606.ENSP00000323587	0.674	Intelectin-1
19	9606.ENSP00000457513	0.673	Cytochrome c oxidase subunit 4 isoform 1, mitochondrial
20	9606.ENSP00000477613	0.665	Baculoviral IAP repeat-containing protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004520	0.999	DNA endonuclease activity
GO:0005515	0.960	protein binding
GO:0042802	0.629	identical protein binding
GO:0004540	0.409	ribonuclease activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0009987	0.989	cellular process
GO:0050794	0.987	regulation of cellular process
GO:0009894	0.976	regulation of catabolic process
GO:0048518	0.974	positive regulation of biological process
GO:0008152	0.960	metabolic process
GO:0031323	0.954	regulation of cellular metabolic process
GO:0048522	0.930	positive regulation of cellular process
GO:0071704	0.912	organic substance metabolic process
GO:0044238	0.907	primary metabolic process
GO:0006807	0.892	nitrogen compound metabolic process
GO:0048583	0.869	regulation of response to stimulus
GO:0009893	0.847	positive regulation of metabolic process
GO:0008219	0.845	cell death
GO:0043170	0.816	macromolecule metabolic process
GO:0050896	0.788	response to stimulus
GO:0031329	0.756	regulation of cellular catabolic process
GO:0044237	0.737	cellular metabolic process
GO:0071840	0.734	cellular component organization or biogenesis
GO:0016043	0.707	cellular component organization
GO:0043067	0.687	regulation of programmed cell death
GO:0048519	0.686	negative regulation of biological process
GO:0051171	0.668	regulation of nitrogen compound metabolic process
GO:0060255	0.664	regulation of macromolecule metabolic process
GO:0080090	0.662	regulation of primary metabolic process
GO:0031325	0.644	positive regulation of cellular metabolic process
GO:0048523	0.638	negative regulation of cellular process
GO:0051173	0.630	positive regulation of nitrogen compound metabolic process
GO:0010604	0.621	positive regulation of macromolecule metabolic process
GO:0048584	0.599	positive regulation of response to stimulus
GO:0009966	0.595	regulation of signal transduction
GO:0080134	0.590	regulation of response to stress
GO:0042221	0.534	response to chemical
GO:0010942	0.531	positive regulation of cell death
GO:0009056	0.506	catabolic process
GO:0051716	0.494	cellular response to stimulus
GO:0043068	0.494	positive regulation of programmed cell death
GO:0019219	0.490	regulation of nucleobase-containing compound metabolic process
GO:0006915	0.489	apoptotic process
GO:1901360	0.488	organic cyclic compound metabolic process
GO:0006725	0.487	cellular aromatic compound metabolic process
GO:0044260	0.474	cellular macromolecule metabolic process
GO:1902531	0.474	regulation of intracellular signal transduction
GO:0010033	0.466	response to organic substance
GO:0090304	0.441	nucleic acid metabolic process
GO:0031331	0.437	positive regulation of cellular catabolic process
GO:0042981	0.427	regulation of apoptotic process
GO:0009057	0.399	macromolecule catabolic process
GO:0044248	0.361	cellular catabolic process
GO:0006950	0.358	response to stress
GO:0007005	0.350	mitochondrion organization
GO:0044265	0.343	cellular macromolecule catabolic process
GO:0006259	0.339	DNA metabolic process
GO:0048585	0.332	negative regulation of response to stimulus
GO:0010506	0.316	regulation of autophagy
GO:0009968	0.315	negative regulation of signal transduction
GO:0032502	0.310	developmental process
GO:0080135	0.309	regulation of cellular response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0005829	0.925	cytosol
GO:0005634	0.803	nucleus
GO:0016020	0.656	membrane
GO:0070013	0.590	intracellular organelle lumen
GO:0032991	0.474	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.-.-	0.999	Acting on ester bonds.

[back to server]