StarFunc result for job id Q14254

User Input

>input (428 residues)
MGNCHTVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRISLEIMTLQPRCEDVE
TAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTV
EQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDAD
IGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLA
YELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQI
AEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALV
LEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLI
KKATGVQV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E7EMK3	0.533	0.475	4.503E-60	483	0.998	0.884	E7EMK3.pdb.gz	E7EMK3_HUMAN Flotillin OS=Homo sapiens OX=9606 GN=FLOT2 PE=1 SV=1
2	AFDB:J3QLD9	0.636	0.636	8.681E-58	428	0.977	0.977	J3QLD9.pdb.gz	J3QLD9_HUMAN Flotillin OS=Homo sapiens OX=9606 GN=FLOT2 PE=1 SV=1
3	AFDB:Q98TZ8	0.498	0.498	2.532E-55	428	0.806	0.806	Q98TZ8.pdb.gz	FLOT2_DANRE Flotillin-2a OS=Danio rerio OX=7955 GN=flot2a PE=2 SV=2
4	AFDB:O61492	0.753	0.737	2.611E-45	438	0.647	0.632	O61492.pdb.gz	FLOT2_DROME Flotillin-2 OS=Drosophila melanogaster OX=7227 GN=Flo2 PE=2 SV=3
5	AFDB:O08917	0.557	0.557	4.035E-38	428	0.467	0.467	O08917.pdb.gz	FLOT1_MOUSE Flotillin-1 OS=Mus musculus OX=10090 GN=Flot1 PE=1 SV=1
6	AFDB:B5X3E3	0.537	0.539	1.241E-37	426	0.439	0.441	B5X3E3.pdb.gz	B5X3E3_SALSA Flotillin OS=Salmo salar OX=8030 GN=FLOT1 PE=2 SV=1
7	AFDB:O61491	0.566	0.568	3.195E-37	426	0.472	0.474	O61491.pdb.gz	FLOT1_DROME Flotillin-1 OS=Drosophila melanogaster OX=7227 GN=Flo1 PE=2 SV=1
8	AFDB:O13127	0.611	0.618	1.173E-36	423	0.430	0.435	O13127.pdb.gz	FLOT1_CARAU Flotillin-1 OS=Carassius auratus OX=7957 GN=flot1 PE=1 SV=1
9	AFDB:W5ULK7	0.560	0.564	5.456E-36	425	0.444	0.447	W5ULK7.pdb.gz	W5ULK7_ICTPU Flotillin OS=Ictalurus punctatus OX=7998 GN=flot1 PE=2 SV=1
10	AFDB:Q5ZHQ3	0.327	0.416	4.726E-25	330	0.638	0.827	Q5ZHQ3.pdb.gz	Q5ZHQ3_CHICK Flotillin OS=Gallus gallus OX=9031 GN=FLOT2 PE=1 SV=1
11	PDB:7vhpG	0.372	0.497	1.178E-11	299	0.107	0.154	7vhpG.pdb.gz
12	PDB:4v60A	0.351	0.205	6.983E-9	812	0.145	0.076	4v60A.pdb.gz
13	PDB:7wi3B	0.302	0.447	2.431E-6	275	0.075	0.116	7wi3B.pdb.gz
14	PDB:4v8mA0	0.195	0.357	8.467E-4	218	0.042	0.083	4v8mA0.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
15	PDB:7mq8NM	0.192	0.335	1.073E-3	233	0.035	0.064	7mq8NM.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:7pzyC	0.187	0.335	1.359E-3	214	0.033	0.065	7pzyC.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
17	PDB:7d4iSC	0.181	0.294	3.298E-3	242	0.028	0.050	7d4iSC.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
18	PDB:4v6wAB	0.189	0.344	3.938E-3	220	0.030	0.059	4v6wAB.pdb.gz	Structures of the human and Drosophila 80S ribosome.
19	PDB:4adfM	0.063	0.101	5.325E-1	191	0.026	0.058	4adfM.pdb.gz
20	PDB:6o22D	0.043	0.100	9.618E-1	164	0.026	0.067	6o22D.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7EMK3	0.0	817	483	0.988	0.876	E7EMK3_HUMAN Flotillin OS=Homo sapiens OX=9606 GN=FLOT2 PE=1 SV=1
2	J3QLD9	0.0	842	428	0.977	0.977	J3QLD9_HUMAN Flotillin OS=Homo sapiens OX=9606 GN=FLOT2 PE=1 SV=1
3	O61492	0.0	575	438	0.645	0.630	FLOT2_DROME Flotillin-2 OS=Drosophila melanogaster OX=7227 GN=Flo2 PE=2 SV=3
4	Q14254	0.0	860	428	1.000	1.000	FLOT2_HUMAN Flotillin-2 OS=Homo sapiens OX=9606 GN=FLOT2 PE=1 SV=2
5	Q5ZHQ3	0.0	540	330	0.640	0.830	Q5ZHQ3_CHICK Flotillin OS=Gallus gallus OX=9031 GN=FLOT2 PE=1 SV=1
6	Q60634	0.0	856	428	0.993	0.993	FLOT2_MOUSE Flotillin-2 OS=Mus musculus OX=10090 GN=Flot2 PE=1 SV=2
7	Q98TZ8	0.0	715	428	0.806	0.806	FLOT2_DANRE Flotillin-2a OS=Danio rerio OX=7955 GN=flot2a PE=2 SV=2
8	Q9BTI6	0.0	754	385	0.874	0.971	Q9BTI6_HUMAN Flotillin OS=Homo sapiens OX=9606 GN=FLOT2 PE=1 SV=1
9	Q9Z2S9	0.0	856	428	0.993	0.993	FLOT2_RAT Flotillin-2 OS=Rattus norvegicus OX=10116 GN=Flot2 PE=1 SV=1
10	O08917	1.12e-129	382	428	0.467	0.467	FLOT1_MOUSE Flotillin-1 OS=Mus musculus OX=10090 GN=Flot1 PE=1 SV=1
11	Q6P2A7	1.12e-129	382	428	0.467	0.467	Q6P2A7_RAT Flotillin OS=Rattus norvegicus OX=10116 PE=2 SV=1
12	Q9Z1E1	2.42e-129	382	428	0.465	0.465	FLOT1_RAT Flotillin-1 OS=Rattus norvegicus OX=10116 GN=Flot1 PE=2 SV=2
13	O75955	3.62e-129	381	427	0.465	0.466	FLOT1_HUMAN Flotillin-1 OS=Homo sapiens OX=9606 GN=FLOT1 PE=1 SV=3
14	Q5ST80	3.62e-129	381	427	0.465	0.466	Q5ST80_HUMAN Flotillin OS=Homo sapiens OX=9606 GN=FLOT1 PE=2 SV=1
15	Q6IB58	4.81e-129	380	427	0.465	0.466	Q6IB58_HUMAN Flotillin OS=Homo sapiens OX=9606 GN=FLOT1 PE=2 SV=1
16	Q767L6	7.19e-129	380	427	0.465	0.466	FLOT1_PIG Flotillin-1 OS=Sus scrofa OX=9823 GN=FLOT1 PE=3 SV=1
17	Q53HQ0	8.31e-127	375	427	0.463	0.464	Q53HQ0_HUMAN Flotillin (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
18	C0H9R4	1.97e-124	369	426	0.442	0.444	C0H9R4_SALSA Flotillin OS=Salmo salar OX=8030 GN=FLOT1 PE=2 SV=1
19	B5X3E3	1.90e-123	366	426	0.439	0.441	B5X3E3_SALSA Flotillin OS=Salmo salar OX=8030 GN=FLOT1 PE=2 SV=1
20	O13127	2.53e-119	356	423	0.430	0.435	FLOT1_CARAU Flotillin-1 OS=Carassius auratus OX=7957 GN=flot1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01145 Band_7	3.3e-17	74.6	SPFH domain / Band 7 family
2	PF15975 Flot	0.093	24.2	Flotillin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000003821

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000024252	0.997	Belongs to the band 7/mec-2 family. Flotillin subfamily.
2	61853.ENSNLEP00000006507	0.915	Cadherin 1
3	61853.ENSNLEP00000013555	0.907	Solute carrier family 6 (neurotransmitter transporter), member 3
4	61853.ENSNLEP00000006991	0.894	Catenin beta 1
5	61853.ENSNLEP00000015937	0.871	Sorbin and SH3 domain containing 1
6	61853.ENSNLEP00000008279	0.870	Coronin, actin binding protein, 1C
7	61853.ENSNLEP00000012773	0.821	Uncharacterized protein
8	61853.ENSNLEP00000020708	0.821	annotation not available
9	61853.ENSNLEP00000020734	0.821	Uncharacterized protein
10	61853.ENSNLEP00000015783	0.787	Catenin delta 1
11	61853.ENSNLEP00000006430	0.719	Cadherin 3
12	61853.ENSNLEP00000001715	0.706	Transporter
13	61853.ENSNLEP00000014017	0.690	May act as a scaffolding protein within caveolar membranes. Forms a stable heterooligomeric complex with CAV2 that targets to lipid rafts and drives caveolae formation. Mediates the recruitment of CAVIN proteins (CAVIN1/2/3/4) to the caveolae (By similarity). Interacts directly with G-protein alpha subunits and can functionally regulate their activity (By similarity). Involved in the costimulatory signal essential for T-cell receptor (TCR)-mediated T-cell activation. Its binding to DPP4 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3-dependent manner (By [...]
14	61853.ENSNLEP00000004400	0.682	Transporter
15	61853.ENSNLEP00000014114	0.630	Leucine rich repeat and fibronectin type III domain containing 3
16	61853.ENSNLEP00000006531	0.611	Prostate tumor overexpressed 1
17	61853.ENSNLEP00000009959	0.576	Caspase recruitment domain family, member 9
18	61853.ENSNLEP00000023519	0.535	Caspase recruitment domain family, member 11
19	61853.ENSNLEP00000007657	0.526	Kinesin-like protein
20	61853.ENSNLEP00000018828	0.523	Synapse differentiation inducing 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.556	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.999	biological regulation
GO:0009987	0.993	cellular process
GO:0050794	0.990	regulation of cellular process
GO:0051641	0.973	cellular localization
GO:0050793	0.971	regulation of developmental process
GO:0048518	0.762	positive regulation of biological process
GO:0051234	0.631	establishment of localization
GO:0048522	0.627	positive regulation of cellular process
GO:0019222	0.591	regulation of metabolic process
GO:0050896	0.568	response to stimulus
GO:0060255	0.515	regulation of macromolecule metabolic process
GO:0006810	0.504	transport
GO:0071840	0.494	cellular component organization or biogenesis
GO:0065008	0.456	regulation of biological quality
GO:0016043	0.429	cellular component organization
GO:0080090	0.425	regulation of primary metabolic process
GO:0031323	0.417	regulation of cellular metabolic process
GO:0030155	0.409	regulation of cell adhesion
GO:0051171	0.408	regulation of nitrogen compound metabolic process
GO:0065009	0.391	regulation of molecular function
GO:0010468	0.385	regulation of gene expression
GO:0051246	0.378	regulation of protein metabolic process
GO:0022407	0.374	regulation of cell-cell adhesion
GO:0051239	0.367	regulation of multicellular organismal process
GO:0048519	0.344	negative regulation of biological process
GO:0051128	0.339	regulation of cellular component organization
GO:0009889	0.337	regulation of biosynthetic process
GO:0008104	0.332	protein localization
GO:0045595	0.326	regulation of cell differentiation
GO:0032502	0.325	developmental process
GO:0048583	0.307	regulation of response to stimulus
GO:0044093	0.301	positive regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	1.000	intracellular anatomical structure
GO:0005886	1.000	plasma membrane
GO:0043227	0.998	membrane-bounded organelle
GO:0043231	0.994	intracellular membrane-bounded organelle
GO:0012505	0.969	endomembrane system
GO:0005737	0.962	cytoplasm
GO:0031982	0.945	vesicle
GO:0032991	0.944	protein-containing complex
GO:0030054	0.902	cell junction
GO:0043230	0.887	extracellular organelle
GO:0005615	0.886	extracellular space
GO:1903561	0.883	extracellular vesicle
GO:0070062	0.872	extracellular exosome
GO:0098590	0.831	plasma membrane region
GO:0098857	0.785	membrane microdomain
GO:0045121	0.724	membrane raft
GO:0098796	0.664	membrane protein complex
GO:0031410	0.579	cytoplasmic vesicle
GO:0005901	0.522	caveola
GO:0098797	0.508	plasma membrane protein complex
GO:0031090	0.484	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]