StarFunc result for job id Q14258

User Input

>input (630 residues)
MAELCPLAEELSCSICLEPFKEPVTTPCGHNFCGSCLNETWAVQGSPYLCPQCRAVYQAR
PQLHKNTVLCNVVEQFLQADLAREPPADVWTPPARASAPSPNAQVACDHCLKEAAVKTCL
VCMASFCQEHLQPHFDSPAFQDHPLQPPVRDLLRRKCSQHNRLREFFCPEHSECICHICL
VEHKTCSPASLSQASADLEATLRHKLTVMYSQINGASRALDDVRNRQQDVRMTANRKVEQ
LQQEYTEMKALLDASETTSTRKIKEEEKRVNSKFDTIYQILLKKKSEIQTLKEEIEQSLT
KRDEFEFLEKASKLRGISTKPVYIPEVELNHKLIKGIHQSTIDLKNELKQCIGRLQEPTP
SSGDPGEHDPASTHKSTRPVKKVSKEEKKSKKPPPVPALPSKLPTFGAPEQLVDLKQAGL
EAAAKATSSHPNSTSLKAKVLETFLAKSRPELLEYYIKVILDYNTAHNKVALSECYTVAS
VAEMPQNYRPHPQRFTYCSQVLGLHCYKKGIHYWEVELQKNNFCGVGICYGSMNRQGPES
RLGRNSASWCVEWFNTKISAWHNNVEKTLPSTKATRVGVLLNCDHGFVIFFAVADKVHLM
YKFRVDFTEALYPAFWVFSAGATLSICSPK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14258	1.000	1.000	0.000	630	1.000	1.000	Q14258.pdb.gz	TRI25_HUMAN E3 ubiquitin/ISG15 ligase TRIM25 OS=Homo sapiens OX=9606 GN=TRIM25 PE=1 SV=2
2	AFDB:Q61510	0.861	0.856	8.727E-93	634	0.740	0.735	Q61510.pdb.gz	TRI25_MOUSE E3 ubiquitin/ISG15 ligase TRIM25 OS=Mus musculus OX=10090 GN=Trim25 PE=1 SV=2
3	AFDB:D4A9N5	0.806	0.791	1.537E-92	643	0.735	0.720	D4A9N5.pdb.gz	D4A9N5_RAT Tripartite motif-containing 25 OS=Rattus norvegicus OX=10116 GN=Trim25 PE=1 SV=3
4	AFDB:A0A0R4IKI3	0.345	0.334	8.498E-56	654	0.341	0.329	A0A0R4IKI3.pdb.gz
5	AFDB:A2BFT4	0.302	0.327	2.070E-44	573	0.265	0.291	A2BFT4.pdb.gz
6	AFDB:B3DFR8	0.300	0.349	7.203E-41	532	0.241	0.286	B3DFR8.pdb.gz
7	AFDB:Q96LD4	0.283	0.279	1.155E-39	638	0.281	0.277	Q96LD4.pdb.gz	TRI47_HUMAN E3 ubiquitin-protein ligase TRIM47 OS=Homo sapiens OX=9606 GN=TRIM47 PE=1 SV=2
8	AFDB:Q8C0E3	0.279	0.274	7.484E-39	641	0.276	0.271	Q8C0E3.pdb.gz	TRI47_MOUSE E3 ubiquitin-protein ligase TRIM47 OS=Mus musculus OX=10090 GN=Trim47 PE=1 SV=2
9	AFDB:Q6P000	0.271	0.302	1.960E-38	564	0.233	0.261	Q6P000.pdb.gz
10	AFDB:Q6PJ69	0.274	0.333	1.998E-37	517	0.219	0.267	Q6PJ69.pdb.gz	TRI65_HUMAN E3 ubiquitin-protein ligase TRIM65 OS=Homo sapiens OX=9606 GN=TRIM65 PE=1 SV=3
11	PDB:7y4sA	0.263	0.469	2.415E-16	343	0.106	0.195	7y4sA.pdb.gz
12	PDB:4cfgA	0.248	0.897	7.218E-15	164	0.256	0.982	4cfgA.pdb.gz
13	PDB:4b3nA	0.243	0.274	1.249E-12	557	0.063	0.072	4b3nA.pdb.gz	Structural Insight Into HIV-1 Capsid Recognition by Rhesus Trim5Alpha
14	PDB:7ccbA	0.210	0.740	3.464E-9	164	0.052	0.201	7ccbA.pdb.gz
15	PDB:7nscA	0.218	0.474	1.629E-7	276	0.049	0.112	7nscA.pdb.gz
16	PDB:6swy1	0.182	0.208	3.958E-5	542	0.054	0.063	6swy1.pdb.gz
17	PDB:7ua3A	0.171	0.026	4.432E-5	4443	0.038	0.005	7ua3A.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.
18	PDB:7z36B	0.118	0.144	6.225E-5	446	0.092	0.130	7z36B.pdb.gz	Structure and functional mapping of the KRAB-KAP1 repressor complex.
19	PDB:6wotA	0.166	0.026	6.588E-5	4197	0.030	0.005	6wotA.pdb.gz	Structural mechanism of two gain-of-function cardiac and skeletal RyR mutations at an equivalent site by cryo-EM.
20	PDB:7nsba	0.193	0.212	1.097E-4	568	0.038	0.042	7nsba.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4A9N5	0.0	952	643	0.733	0.719	D4A9N5_RAT Tripartite motif-containing 25 OS=Rattus norvegicus OX=10116 GN=Trim25 PE=1 SV=3
2	Q14258	0.0	1310	630	1.000	1.000	TRI25_HUMAN E3 ubiquitin/ISG15 ligase TRIM25 OS=Homo sapiens OX=9606 GN=TRIM25 PE=1 SV=2
3	Q61510	0.0	964	634	0.740	0.735	TRI25_MOUSE E3 ubiquitin/ISG15 ligase TRIM25 OS=Mus musculus OX=10090 GN=Trim25 PE=1 SV=2
4	Q6P7B3	0.0	951	643	0.732	0.717	Q6P7B3_RAT Tripartite motif-containing 25 OS=Rattus norvegicus OX=10116 GN=Trim25 PE=2 SV=1
5	A0A2R8QTG3	2.40e-132	404	645	0.351	0.343	A0A2R8QTG3_DANRE E3 ubiquitin/ISG15 ligase TRIM25 isoform X1 OS=Danio rerio OX=7955 GN=zgc:55773 PE=1 SV=1
6	Q7ZVQ7	9.53e-130	398	654	0.354	0.341	Q7ZVQ7_DANRE E3 ubiquitin/ISG15 ligase TRIM25 OS=Danio rerio OX=7955 GN=zgc:55773 PE=1 SV=1
7	Q08CC1	7.74e-73	246	573	0.284	0.312	Q08CC1_DANRE FinTRIM family, member 82 OS=Danio rerio OX=7955 GN=si:dkey-252h13.6 PE=1 SV=1
8	Q99PP9	5.03e-41	159	556	0.210	0.237	TRI16_MOUSE Tripartite motif-containing protein 16 OS=Mus musculus OX=10090 GN=Trim16 PE=1 SV=2
9	A0A0R4IUT0	2.75e-35	142	544	0.137	0.158	A0A0R4IUT0_DANRE Bloodthirsty-related gene family, member 20 OS=Danio rerio OX=7955 GN=btr20 PE=4 SV=1
10	O15344	5.15e-35	143	667	0.260	0.246	TRI18_HUMAN E3 ubiquitin-protein ligase Midline-1 OS=Homo sapiens OX=9606 GN=MID1 PE=1 SV=1
11	O95361	6.57e-33	135	564	0.208	0.232	TRI16_HUMAN Tripartite motif-containing protein 16 OS=Homo sapiens OX=9606 GN=TRIM16 PE=1 SV=3
12	O70583	2.23e-31	132	680	0.263	0.244	TRI18_MOUSE E3 ubiquitin-protein ligase Midline-1 OS=Mus musculus OX=10090 GN=Mid1 PE=1 SV=2
13	Q9UJV3	4.97e-31	131	735	0.259	0.222	TRIM1_HUMAN Probable E3 ubiquitin-protein ligase MID2 OS=Homo sapiens OX=9606 GN=MID2 PE=1 SV=3
14	F1QYX5	6.89e-28	120	582	0.237	0.256	F1QYX5_DANRE Bloodthirsty-related gene family, member 1 OS=Danio rerio OX=7955 GN=btr01 PE=4 SV=2
15	A0A024RCP5	1.62e-27	119	518	0.222	0.270	A0A024RCP5_HUMAN TRIM39 OS=Homo sapiens OX=9606 PE=4 SV=1
16	Q9HCM9	1.62e-27	119	518	0.222	0.270	TRI39_HUMAN E3 ubiquitin-protein ligase TRIM39 OS=Homo sapiens OX=9606 GN=TRIM39 PE=1 SV=2
17	Q9BZR9	1.46e-25	113	551	0.135	0.154	TRIM8_HUMAN E3 ubiquitin-protein ligase TRIM8 OS=Homo sapiens OX=9606 GN=TRIM8 PE=1 SV=2
18	Q99PJ2	2.98e-25	112	551	0.133	0.152	TRIM8_MOUSE E3 ubiquitin-protein ligase TRIM8 OS=Mus musculus OX=10090 GN=Trim8 PE=1 SV=3
19	E7FCI6	1.18e-24	110	567	0.135	0.150	E7FCI6_DANRE Probable E3 ubiquitin-protein ligase TRIM8 isoform X1 OS=Danio rerio OX=7955 GN=trim8a PE=4 SV=2
20	J9UF94	1.74e-24	110	560	0.135	0.152	J9UF94_DANRE Probable E3 ubiquitin-protein ligase TRIM8 OS=Danio rerio OX=7955 GN=trim8a PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02601 Exonuc_VII_L	1.8e+02	13.1	Exonuclease VII, large subunit
2	PF15819 Fibin	8.8e+02	11.1	Fin bud initiation factor homologue
3	PF18256 HscB_4_cys	6.7e+02	11.5	Co-chaperone HscB tetracysteine metal binding motif
4	PF08858 IDEAL	5.4e+02	11.7	IDEAL domain
5	PF03340 Pox_Rif	85	13.0	Poxvirus rifampicin resistance protein
6	PF14447 Prok-RING_4	4.4	18.6	Prokaryotic RING finger family 4
7	PF13765 PRY	5.7e-10	50.0	SPRY-associated domain
8	PF00622 SPRY	2.1e-10	52.1	SPRY domain
9	PF00643 zf-B_box	47	15.6	B-box zinc finger
10	PF00097 zf-C3HC4	8.2e-06	36.9	Zinc finger, C3HC4 type (RING finger)
11	PF13923 zf-C3HC4_2	8e-05	33.7	Zinc finger, C3HC4 type (RING finger)
12	PF13920 zf-C3HC4_3	0.00026	32.1	Zinc finger, C3HC4 type (RING finger)
13	PF15227 zf-C3HC4_4	6.7e-06	37.4	zinc finger of C3HC4-type, RING
14	PF13639 zf-RING_2	4.1e-05	35.2	Ring finger domain
15	PF14634 zf-RING_5	0.00017	32.8	zinc-RING finger domain
16	PF13445 zf-RING_UBOX	5.5e-07	40.8	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000323889

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000369213	0.999	Probable ATP-dependent RNA helicase DDX58
2	9606.ENSP00000316176	0.997	Ubiquitin-conjugating enzyme E2 N
3	9606.ENSP00000363019	0.994	Ubiquitin-conjugating enzyme E2 D1
4	9606.ENSP00000401980	0.985	Mitochondrial antiviral-signaling protein
5	9606.ENSP00000264350	0.957	E3 ISG15--protein ligase HERC5
6	9606.ENSP00000333266	0.954	Ubiquitin-like modifier-activating enzyme 7
7	9606.ENSP00000354394	0.954	Signal transducer and activator of transcription 1-alpha/beta
8	9606.ENSP00000360869	0.950	Interferon-induced protein with tetratricopeptide repeats 1
9	9606.ENSP00000369217	0.949	E3 ubiquitin-protein ligase ARIH1
10	9606.ENSP00000156084	0.948	OTU domain-containing protein 5
11	9606.ENSP00000381601	0.948	Interferon-induced GTP-binding protein Mx1
12	9606.ENSP00000405330	0.948	Estrogen receptor
13	9606.ENSP00000441543	0.947	Polyubiquitin-C
14	9606.ENSP00000387334	0.945	NLR family member X1
15	9606.ENSP00000272317	0.944	Ubiquitin-40S ribosomal protein S27a
16	9606.ENSP00000263642	0.940	Interferon-induced helicase C domain-containing protein 1
17	9606.ENSP00000264335	0.940	14-3-3 protein epsilon
18	9606.ENSP00000233057	0.939	Interferon-induced, double-stranded RNA-activated protein kinase
19	9606.ENSP00000333657	0.939	Interferon-induced GTP-binding protein Mx2
20	9606.ENSP00000303709	0.938	Ubiquitin-conjugating enzyme E2 E1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.995	catalytic activity
GO:0140096	0.988	catalytic activity, acting on a protein
GO:0004842	0.981	ubiquitin-protein transferase activity
GO:1901363	0.953	heterocyclic compound binding
GO:0097159	0.953	organic cyclic compound binding
GO:0003676	0.907	nucleic acid binding
GO:0061630	0.818	ubiquitin protein ligase activity
GO:0003723	0.734	RNA binding
GO:0042802	0.644	identical protein binding
GO:0140110	0.425	transcription regulator activity
GO:0003713	0.379	transcription coactivator activity
GO:0045296	0.369	cadherin binding
GO:0005102	0.333	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.988	response to stimulus
GO:0050789	0.988	regulation of biological process
GO:0050794	0.981	regulation of cellular process
GO:0071704	0.978	organic substance metabolic process
GO:0006807	0.966	nitrogen compound metabolic process
GO:0009987	0.964	cellular process
GO:0044238	0.964	primary metabolic process
GO:1903900	0.943	regulation of viral life cycle
GO:0043903	0.939	regulation of biological process involved in symbiotic interaction
GO:0006950	0.927	response to stress
GO:0009605	0.926	response to external stimulus
GO:0043170	0.925	macromolecule metabolic process
GO:0046596	0.911	regulation of viral entry into host cell
GO:0042221	0.900	response to chemical
GO:0048583	0.884	regulation of response to stimulus
GO:0044419	0.878	biological process involved in interspecies interaction between organisms
GO:0048518	0.874	positive regulation of biological process
GO:1901564	0.852	organonitrogen compound metabolic process
GO:0019222	0.850	regulation of metabolic process
GO:0045087	0.848	innate immune response
GO:0006508	0.827	proteolysis
GO:0010033	0.820	response to organic substance
GO:0051090	0.815	regulation of DNA-binding transcription factor activity
GO:0048522	0.804	positive regulation of cellular process
GO:0051091	0.804	positive regulation of DNA-binding transcription factor activity
GO:0051716	0.794	cellular response to stimulus
GO:0048519	0.791	negative regulation of biological process
GO:0044237	0.783	cellular metabolic process
GO:0009057	0.777	macromolecule catabolic process
GO:0009719	0.770	response to endogenous stimulus
GO:1901565	0.741	organonitrogen compound catabolic process
GO:0009966	0.735	regulation of signal transduction
GO:0048525	0.733	negative regulation of viral process
GO:0036211	0.698	protein modification process
GO:0009725	0.677	response to hormone
GO:0051092	0.663	positive regulation of NF-kappaB transcription factor activity
GO:0030163	0.662	protein catabolic process
GO:0070647	0.599	protein modification by small protein conjugation or removal
GO:0043627	0.581	response to estrogen
GO:0009615	0.566	response to virus
GO:1901700	0.564	response to oxygen-containing compound
GO:0009991	0.485	response to extracellular stimulus
GO:0048584	0.452	positive regulation of response to stimulus
GO:0044260	0.446	cellular macromolecule metabolic process
GO:0051603	0.437	proteolysis involved in protein catabolic process
GO:0032446	0.395	protein modification by small protein conjugation
GO:0009893	0.391	positive regulation of metabolic process
GO:1902533	0.379	positive regulation of intracellular signal transduction
GO:0080134	0.375	regulation of response to stress
GO:0043122	0.364	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0035891	0.363	exit from host cell
GO:0051607	0.357	defense response to virus
GO:0016567	0.345	protein ubiquitination
GO:0048523	0.327	negative regulation of cellular process
GO:0010604	0.322	positive regulation of macromolecule metabolic process
GO:0044248	0.302	cellular catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0031981	0.986	nuclear lumen
GO:0005654	0.979	nucleoplasm
GO:0005829	0.971	cytosol
GO:0043232	0.922	intracellular non-membrane-bounded organelle
GO:0016604	0.534	nuclear body
GO:0099080	0.461	supramolecular complex
GO:0010494	0.311	cytoplasmic stress granule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.982	Transferases.

[back to server]