StarFunc result for job id Q14289

User Input

>input (1009 residues)
MSGVSEPLSRVKLGTLRRPEGPAEPMVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVK
CTVQTEIREIITSILLSGRIGPNIRLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYEC
LHVEAEWRYDLQIRYLPEDFMESLKEDRTTLLYFYQQLRNDYMQRYASKVSEGMALQLGC
LELRRFFKDMPHNALDKKSNFELLEKEVGLDLFFPKQMQENLKPKQFRKMIQQTFQQYAS
LREEECVMKFFNTLAGFANIDQETYRCELIQGWNITVDLVIGPKGIRQLTSQDAKPTCLA
EFKQIRSIRCLPLEEGQAVLQLGIEGAPQALSIKTSSLAEAENMADLIDGYCRLQGEHQG
SLIIHPRKDGEKRNSLPQIPMLNLEARRSHLSESCSIESDIYAEIPDETLRRPGGPQYGI
AREDVVLNRILGEGFFGEVYEGVYTNHKGEKINVAVKTCKKDCTLDNKEKFMSEAVIMKN
LDHPHIVKLIGIIEEEPTWIIMELYPYGELGHYLERNKNSLKVLTLVLYSLQICKAMAYL
ESINCVHRDIAVRNILVASPECVKLGDFGLSRYIEDEDYYKASVTRLPIKWMSPESINFR
RFTTASDVWMFAVCMWEILSFGKQPFFWLENKDVIGVLEKGDRLPKPDLCPPVLYTLMTR
CWDYDPSDRPRFTELVCSLSDVYQMEKDIAMEQERNARYRTPKILEPTAFQEPPPKPSRP
KYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMR
EEDFIQPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDPMVYMNDKSP
LTPEKEVGYLEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYLNVMELVRAVLELKNELCQ
LPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLA
QQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAHPPAE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P70600	0.748	0.748	0.000	1009	0.956	0.956	P70600.pdb.gz	FAK2_RAT Protein-tyrosine kinase 2-beta OS=Rattus norvegicus OX=10116 GN=Ptk2b PE=1 SV=1
2	AFDB:E7ESA6	0.589	0.545	1.706E-85	1096	0.466	0.429	E7ESA6.pdb.gz	E7ESA6_HUMAN non-specific protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=PTK2 PE=1 SV=1
3	AFDB:A0A2R8RR02	0.594	0.547	6.529E-85	1101	0.462	0.423	A0A2R8RR02.pdb.gz	A0A2R8RR02_DANRE non-specific protein-tyrosine kinase OS=Danio rerio OX=7955 GN=fak PE=1 SV=1
4	AFDB:Q0E917	0.542	0.466	1.849E-65	1200	0.333	0.280	Q0E917.pdb.gz	Q0E917_DROME FI18818p1 OS=Drosophila melanogaster OX=7227 GN=Fak PE=2 SV=1
5	AFDB:B7YZL9	0.535	0.372	1.203E-62	1500	0.346	0.233	B7YZL9.pdb.gz	B7YZL9_DROME Focal adhesion kinase, isoform D OS=Drosophila melanogaster OX=7227 GN=Fak PE=4 SV=1
6	AFDB:G1NJW4	0.271	0.680	2.590E-30	393	0.164	0.420	G1NJW4.pdb.gz	G1NJW4_MELGA Protein kinase domain-containing protein OS=Meleagris gallopavo OX=9103 PE=4 SV=3
7	AFDB:G1TCI4	0.255	0.229	9.135E-29	1132	0.172	0.154	G1TCI4.pdb.gz	G1TCI4_RABIT Tyrosine-protein kinase OS=Oryctolagus cuniculus OX=9986 GN=JAK2 PE=3 SV=2
8	AFDB:B0V237	0.264	0.242	2.330E-27	1103	0.164	0.150	B0V237.pdb.gz	B0V237_DANRE Tyrosine-protein kinase OS=Danio rerio OX=7955 GN=jak3 PE=3 SV=1
9	AFDB:Q06418	0.275	0.310	2.835E-26	890	0.129	0.146	Q06418.pdb.gz	TYRO3_HUMAN Tyrosine-protein kinase receptor TYRO3 OS=Homo sapiens OX=9606 GN=TYRO3 PE=1 SV=1
10	AFDB:P55144	0.272	0.310	1.190E-25	880	0.133	0.152	P55144.pdb.gz	TYRO3_MOUSE Tyrosine-protein kinase receptor TYRO3 OS=Mus musculus OX=10090 GN=Tyro3 PE=1 SV=2
11	PDB:4fl2A	0.245	0.435	3.539E-20	555	0.121	0.220	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
12	PDB:2h8hA	0.241	0.531	1.418E-19	445	0.115	0.261	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
13	PDB:4k2rA	0.241	0.434	1.707E-19	551	0.112	0.205	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
14	PDB:1k9aB	0.249	0.557	3.262E-19	441	0.122	0.279	1k9aB.pdb.gz
15	PDB:4rerA	0.232	0.496	5.732E-14	459	0.068	0.150	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
16	PDB:6s73A	0.227	0.802	1.586E-13	269	0.063	0.238	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
17	PDB:6b1uA	0.228	0.498	2.520E-13	442	0.075	0.172	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
18	PDB:4rewA	0.235	0.552	2.639E-13	411	0.068	0.168	4rewA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
19	PDB:4zhxA	0.230	0.542	2.895E-13	409	0.066	0.164	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
20	PDB:4eomC	0.229	0.782	3.821E-13	276	0.056	0.203	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8RR02	0.0	801	1101	0.463	0.424	A0A2R8RR02_DANRE non-specific protein-tyrosine kinase OS=Danio rerio OX=7955 GN=fak PE=1 SV=1
2	E7ESA6	0.0	825	1096	0.463	0.426	E7ESA6_HUMAN non-specific protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=PTK2 PE=1 SV=1
3	H0YB16	0.0	557	724	0.328	0.457	H0YB16_HUMAN Protein tyrosine kinase 2 (Fragment) OS=Homo sapiens OX=9606 GN=PTK2 PE=1 SV=1
4	H0YBP1	0.0	826	1017	0.459	0.455	H0YBP1_HUMAN non-specific protein-tyrosine kinase (Fragment) OS=Homo sapiens OX=9606 GN=PTK2 PE=1 SV=1
5	O35346	0.0	832	1055	0.469	0.448	FAK1_RAT Focal adhesion kinase 1 OS=Rattus norvegicus OX=10116 GN=Ptk2 PE=1 SV=1
6	P34152	0.0	830	1052	0.463	0.444	FAK1_MOUSE Focal adhesion kinase 1 OS=Mus musculus OX=10090 GN=Ptk2 PE=1 SV=4
7	P70600	0.0	1984	1009	0.956	0.956	FAK2_RAT Protein-tyrosine kinase 2-beta OS=Rattus norvegicus OX=10116 GN=Ptk2b PE=1 SV=1
8	Q00944	0.0	822	1053	0.465	0.445	FAK1_CHICK Focal adhesion kinase 1 OS=Gallus gallus OX=9031 GN=PTK2 PE=1 SV=2
9	Q05397	0.0	825	1052	0.463	0.444	FAK1_HUMAN Focal adhesion kinase 1 OS=Homo sapiens OX=9606 GN=PTK2 PE=1 SV=2
10	Q14289	0.0	2090	1009	1.000	1.000	FAK2_HUMAN Protein-tyrosine kinase 2-beta OS=Homo sapiens OX=9606 GN=PTK2B PE=1 SV=2
11	Q98SN4	0.0	810	1050	0.463	0.445	Q98SN4_DANRE non-specific protein-tyrosine kinase OS=Danio rerio OX=7955 GN=fak1a PE=1 SV=1
12	Q9QVP9	0.0	1981	1009	0.954	0.954	FAK2_MOUSE Protein-tyrosine kinase 2-beta OS=Mus musculus OX=10090 GN=Ptk2b PE=1 SV=2
13	I6L996	1.28e-172	522	680	0.305	0.453	I6L996_HUMAN PTK2 protein OS=Homo sapiens OX=9606 GN=PTK2 PE=1 SV=1
14	Q0E917	5.96e-165	518	1200	0.339	0.285	Q0E917_DROME FI18818p1 OS=Drosophila melanogaster OX=7227 GN=Fak PE=2 SV=1
15	Q9U472	6.28e-165	518	1200	0.339	0.285	Q9U472_DROME Focal adhesion kinase homolog FAK56 OS=Drosophila melanogaster OX=7227 GN=Fak PE=2 SV=1
16	Q9U531	1.08e-164	517	1200	0.339	0.285	Q9U531_DROME Focal adhesion kinase homolog DFak56 OS=Drosophila melanogaster OX=7227 GN=Fak PE=2 SV=1
17	E1JGM8	1.29e-164	517	1198	0.339	0.285	E1JGM8_DROME Focal adhesion kinase, isoform F OS=Drosophila melanogaster OX=7227 GN=Fak PE=4 SV=1
18	Q5BIG9	1.03e-161	509	1200	0.337	0.283	Q5BIG9_DROME RE57482p OS=Drosophila melanogaster OX=7227 GN=Fak PE=2 SV=1
19	Q9U5Y2	2.01e-160	506	1198	0.336	0.283	Q9U5Y2_DROME Focal adhesion kinase OS=Drosophila melanogaster OX=7227 GN=Fak PE=2 SV=1
20	B7YZL9	1.61e-129	429	1500	0.255	0.171	B7YZL9_DROME Focal adhesion kinase, isoform D OS=Drosophila melanogaster OX=7227 GN=Fak PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18377 FERM_F2	1.1e+02	14.1	FERM F2 acyl-CoA binding protein-like domain
2	PF00373 FERM_M	3.2e-06	38.9	FERM central domain
3	PF18038 FERM_N_2	2.8e-43	157.9	FERM N-terminal domain
4	PF03623 Focal_AT	1.1e-52	189.0	Focal adhesion targeting region
5	PF14531 Kinase-like	72	14.2	Kinase-like
6	PF00069 Pkinase	3.5e-39	146.4	Protein kinase domain
7	PF07714 PK_Tyr_Ser-Thr	4.7e-90	313.0	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000380638

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000267257	0.999	Paxillin
2	9606.ENSP00000376345	0.999	Growth factor receptor-bound protein 2
3	9606.ENSP00000391669	0.999	Breast cancer anti-estrogen resistance protein 1
4	9606.ENSP00000401303	0.995	SHC-transforming protein 1
5	9606.ENSP00000431284	0.994	Leupaxin
6	9606.ENSP00000452786	0.991	Integrin beta-3
7	9606.ENSP00000346671	0.988	Tyrosine-protein kinase Fyn
8	9606.ENSP00000378332	0.988	Transforming growth factor beta-1-induced transcript 1 protein
9	9606.ENSP00000340944	0.987	Tyrosine-protein phosphatase non-receptor type 11
10	9606.ENSP00000362680	0.984	Proto-oncogene tyrosine-protein kinase Src
11	9606.ENSP00000382428	0.982	Disks large homolog 4
12	9606.ENSP00000275493	0.980	Epidermal growth factor receptor
13	9606.ENSP00000300574	0.979	Adapter molecule crk
14	9606.ENSP00000264033	0.978	E3 ubiquitin-protein ligase CBL
15	9606.ENSP00000262483	0.976	Membrane-associated phosphatidylinositol transfer protein 3
16	9606.ENSP00000379818	0.975	Glutamate receptor ionotropic, NMDA 2A
17	9606.ENSP00000379350	0.967	Integrin beta-1
18	9606.ENSP00000378217	0.954	Protein kinase C delta type
19	9606.ENSP00000391676	0.950	Tyrosine-protein kinase JAK3
20	9606.ENSP00000378974	0.949	Mitogen-activated protein kinase 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0004713	0.997	protein tyrosine kinase activity
GO:0044877	0.841	protein-containing complex binding
GO:0019899	0.824	enzyme binding
GO:0004715	0.696	non-membrane spanning protein tyrosine kinase activity
GO:0005102	0.667	signaling receptor binding
GO:0004674	0.488	protein serine/threonine kinase activity
GO:0050839	0.470	cell adhesion molecule binding
GO:0019900	0.407	kinase binding
GO:0019901	0.393	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.987	response to stimulus
GO:0009987	0.987	cellular process
GO:0048518	0.986	positive regulation of biological process
GO:0050794	0.983	regulation of cellular process
GO:0008152	0.977	metabolic process
GO:0051716	0.972	cellular response to stimulus
GO:0051128	0.972	regulation of cellular component organization
GO:0048583	0.961	regulation of response to stimulus
GO:0007166	0.961	cell surface receptor signaling pathway
GO:0006793	0.959	phosphorus metabolic process
GO:0018212	0.953	peptidyl-tyrosine modification
GO:0006468	0.951	protein phosphorylation
GO:0032501	0.936	multicellular organismal process
GO:0010646	0.930	regulation of cell communication
GO:0065008	0.929	regulation of biological quality
GO:0023051	0.928	regulation of signaling
GO:0032502	0.921	developmental process
GO:0048522	0.920	positive regulation of cellular process
GO:0048519	0.907	negative regulation of biological process
GO:0044087	0.897	regulation of cellular component biogenesis
GO:0051239	0.896	regulation of multicellular organismal process
GO:0019222	0.896	regulation of metabolic process
GO:0048523	0.896	negative regulation of cellular process
GO:0009893	0.882	positive regulation of metabolic process
GO:0051171	0.878	regulation of nitrogen compound metabolic process
GO:0042127	0.875	regulation of cell population proliferation
GO:0042221	0.873	response to chemical
GO:0031323	0.871	regulation of cellular metabolic process
GO:0080090	0.868	regulation of primary metabolic process
GO:0060255	0.866	regulation of macromolecule metabolic process
GO:0007167	0.846	enzyme-linked receptor protein signaling pathway
GO:0051347	0.825	positive regulation of transferase activity
GO:0030335	0.822	positive regulation of cell migration
GO:0050730	0.816	regulation of peptidyl-tyrosine phosphorylation
GO:0042327	0.810	positive regulation of phosphorylation
GO:0043549	0.806	regulation of kinase activity
GO:0001934	0.802	positive regulation of protein phosphorylation
GO:0010033	0.793	response to organic substance
GO:0046777	0.790	protein autophosphorylation
GO:0070887	0.789	cellular response to chemical stimulus
GO:0023056	0.787	positive regulation of signaling
GO:0010647	0.787	positive regulation of cell communication
GO:0048856	0.772	anatomical structure development
GO:0050793	0.766	regulation of developmental process
GO:0045859	0.762	regulation of protein kinase activity
GO:0009967	0.759	positive regulation of signal transduction
GO:0033674	0.757	positive regulation of kinase activity
GO:1902531	0.753	regulation of intracellular signal transduction
GO:0032879	0.751	regulation of localization
GO:0018108	0.749	peptidyl-tyrosine phosphorylation
GO:0045860	0.749	positive regulation of protein kinase activity
GO:0030155	0.740	regulation of cell adhesion
GO:0035556	0.728	intracellular signal transduction
GO:0030154	0.727	cell differentiation
GO:0051049	0.726	regulation of transport
GO:0010941	0.706	regulation of cell death
GO:0051240	0.706	positive regulation of multicellular organismal process
GO:0071840	0.668	cellular component organization or biogenesis
GO:0033043	0.651	regulation of organelle organization
GO:0071310	0.648	cellular response to organic substance
GO:0016043	0.639	cellular component organization
GO:1901700	0.635	response to oxygen-containing compound
GO:0007169	0.632	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0008284	0.483	positive regulation of cell population proliferation
GO:0007275	0.430	multicellular organism development
GO:1902533	0.417	positive regulation of intracellular signal transduction
GO:0010468	0.411	regulation of gene expression
GO:0042981	0.399	regulation of apoptotic process
GO:0009719	0.381	response to endogenous stimulus
GO:0043066	0.379	negative regulation of apoptotic process
GO:2000026	0.349	regulation of multicellular organismal development
GO:0002682	0.339	regulation of immune system process
GO:0048731	0.335	system development
GO:0051179	0.323	localization
GO:0080134	0.313	regulation of response to stress
GO:0009653	0.310	anatomical structure morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0030054	0.999	cell junction
GO:0070161	0.993	anchoring junction
GO:0005634	0.991	nucleus
GO:0005829	0.986	cytosol
GO:0030055	0.982	cell-substrate junction
GO:0016020	0.978	membrane
GO:0005886	0.974	plasma membrane
GO:0005925	0.973	focal adhesion
GO:0045202	0.968	synapse
GO:0043232	0.967	intracellular non-membrane-bounded organelle
GO:0098794	0.868	postsynapse
GO:0048471	0.826	perinuclear region of cytoplasm
GO:0098984	0.812	neuron to neuron synapse
GO:0014069	0.800	postsynaptic density
GO:0032991	0.715	protein-containing complex
GO:0043233	0.710	organelle lumen
GO:0070013	0.704	intracellular organelle lumen
GO:0098978	0.664	glutamatergic synapse
GO:0042995	0.658	cell projection
GO:0120025	0.653	plasma membrane bounded cell projection
GO:0005654	0.459	nucleoplasm
GO:0099091	0.370	postsynaptic specialization, intracellular component
GO:0012505	0.336	endomembrane system
GO:0031982	0.308	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10596	0.997	ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]
EC:2.7.10.2	0.696	non-specific protein-tyrosine kinase.

[back to server]