StarFunc result for job id Q14314

User Input

>input (439 residues)
MKLANWYWLSSAVLATYGFLVVANNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVS
LPPLTIQLPKQFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTG
APGEVGDNRVRELESEVNKLSSELKNAKEEINVLHGRLEKLNLVNMNNIENYVDSKVANL
TFVVNSLDGKCSKCPSQEQIQSRPVQHLIYKDCSDYYAIGKRSSETYRVTPDPKNSSFEV
YCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMIL
RIDLEDFNGVELYALYDQFYVANEFLKYRLHVGNYNGTAGDALRFNKHYNHDLKFFTTPD
KDNDRYPSGNCGLYYSSGWWFDACLSANLNGKYYHQKYRGVRNGIFWGTWPGVSEAHPGG
YKSSFKEAKMMIRPKHFKP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14314	1.000	1.000	1.601E-79	439	1.000	1.000	Q14314.pdb.gz	FGL2_HUMAN Fibroleukin OS=Homo sapiens OX=9606 GN=FGL2 PE=1 SV=1
2	AFDB:Q8MIP7	0.601	0.598	6.910E-72	442	0.893	0.887	Q8MIP7.pdb.gz	Q8MIP7_PIG Fibrinogen-like protein 2 OS=Sus scrofa OX=9823 GN=FGL2 PE=4 SV=1
3	AFDB:P12804	0.589	0.598	2.982E-64	432	0.774	0.787	P12804.pdb.gz	FGL2_MOUSE Fibroleukin OS=Mus musculus OX=10090 GN=Fgl2 PE=1 SV=1
4	AFDB:O15123	0.480	0.427	8.785E-30	496	0.296	0.262	O15123.pdb.gz	ANGP2_HUMAN Angiopoietin-2 OS=Homo sapiens OX=9606 GN=ANGPT2 PE=1 SV=1
5	AFDB:Q5KQU0	0.469	0.430	1.239E-29	480	0.282	0.258	Q5KQU0.pdb.gz	Q5KQU0_DANRE Angiopoietin-like 1 OS=Danio rerio OX=7955 GN=Angptl1 PE=2 SV=1
6	AFDB:Q1LWR7	0.478	0.430	1.312E-29	489	0.285	0.256	Q1LWR7.pdb.gz
7	AFDB:B3DJK2	0.479	0.412	1.849E-29	513	0.289	0.248	B3DJK2.pdb.gz
8	AFDB:Q02020	0.478	0.454	1.958E-29	463	0.292	0.276	Q02020.pdb.gz	FIBB_CHICK Fibrinogen beta chain (Fragment) OS=Gallus gallus OX=9031 GN=FGB PE=1 SV=1
9	AFDB:P02675	0.480	0.431	2.325E-29	491	0.305	0.273	P02675.pdb.gz	FIBB_HUMAN Fibrinogen beta chain OS=Homo sapiens OX=9606 GN=FGB PE=1 SV=2
10	AFDB:Q8K0E8	0.480	0.439	2.761E-29	481	0.298	0.272	Q8K0E8.pdb.gz	FIBB_MOUSE Fibrinogen beta chain OS=Mus musculus OX=10090 GN=Fgb PE=1 SV=1
11	PDB:1m1jB	0.478	0.520	1.385E-27	402	0.276	0.301	1m1jB.pdb.gz	Crystal Structure of Native Chicken Fibrinogen at 2.7 A Resolution
12	PDB:1jc9A	0.468	0.921	3.668E-27	220	0.207	0.414	1jc9A.pdb.gz	The 2.0-A crystal structure of tachylectin 5A provides evidence for the common origin of the innate immunity and the blood coagulation systems.
13	PDB:3ghgB	0.477	0.521	2.292E-26	401	0.289	0.317	3ghgB.pdb.gz	Crystal structure of human fibrinogen.
14	PDB:3ghgI	0.473	0.525	6.803E-26	394	0.278	0.310	3ghgI.pdb.gz	Crystal structure of human fibrinogen.
15	PDB:1ei3C	0.473	0.521	4.711E-24	397	0.262	0.290	1ei3C.pdb.gz
16	PDB:4wmqA	0.201	0.285	1.760E-4	283	0.059	0.092	4wmqA.pdb.gz	Recognition of microbial glycans by human intelectin-1.
17	PDB:5zc0A	0.171	0.250	1.760E-4	281	0.052	0.082	5zc0A.pdb.gz	Structural stabilities of calcium proteins: Human intelectin-1 and frog lectin XEEL
18	PDB:7fdeP	0.163	0.300	8.063E-2	181	0.050	0.122	7fdeP.pdb.gz
19	PDB:6l08A	0.044	0.067	1.061	285	0.011	0.018	6l08A.pdb.gz
20	PDB:4qvbB	0.084	0.216	1.190	144	0.018	0.056	4qvbB.pdb.gz	Molecular insights into the binding of coenzyme F420 to the conserved protein Rv1155 from Mycobacterium tuberculosis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G3V7P2	0.0	679	429	0.772	0.790	G3V7P2_RAT Fibrinogen-like 2 OS=Rattus norvegicus OX=10116 GN=Fgl2 PE=4 SV=1
2	P12804	0.0	716	432	0.777	0.789	FGL2_MOUSE Fibroleukin OS=Mus musculus OX=10090 GN=Fgl2 PE=1 SV=1
3	Q14314	0.0	918	439	1.000	1.000	FGL2_HUMAN Fibroleukin OS=Homo sapiens OX=9606 GN=FGL2 PE=1 SV=1
4	Q32Q89	0.0	676	427	0.770	0.792	Q32Q89_RAT Fgl2 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Fgl2 PE=2 SV=1
5	Q5U3X5	0.0	672	422	0.765	0.796	Q5U3X5_RAT Fgl2 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Fgl2 PE=2 SV=1
6	Q6IN12	0.0	665	419	0.759	0.795	Q6IN12_RAT Fgl2 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Fgl2 PE=2 SV=1
7	Q8MIP7	0.0	832	442	0.893	0.887	Q8MIP7_PIG Fibrinogen-like protein 2 OS=Sus scrofa OX=9823 GN=FGL2 PE=4 SV=1
8	O35608	2.58e-55	192	496	0.264	0.234	ANGP2_MOUSE Angiopoietin-2 OS=Mus musculus OX=10090 GN=Angpt2 PE=2 SV=2
9	F1QG23	5.68e-55	187	335	0.269	0.352	F1QG23_DANRE Fibrinogen-like protein 1 isoform X2 OS=Danio rerio OX=7955 GN=si:ch211-287a12.9 PE=4 SV=2
10	Q71KU9	3.75e-54	184	314	0.244	0.341	FGL1_MOUSE Fibrinogen-like protein 1 OS=Mus musculus OX=10090 GN=Fgl1 PE=1 SV=2
11	Q08830	3.90e-54	184	312	0.244	0.343	FGL1_HUMAN Fibrinogen-like protein 1 OS=Homo sapiens OX=9606 GN=FGL1 PE=1 SV=3
12	O15123	2.20e-53	187	496	0.251	0.222	ANGP2_HUMAN Angiopoietin-2 OS=Homo sapiens OX=9606 GN=ANGPT2 PE=1 SV=1
13	O35462	4.39e-51	181	496	0.251	0.222	ANGP2_RAT Angiopoietin-2 OS=Rattus norvegicus OX=10116 GN=Angpt2 PE=2 SV=2
14	Q9U8W7	6.00e-51	176	316	0.221	0.307	TL5B_TACTR Techylectin-5B OS=Tachypleus tridentatus OX=6853 PE=1 SV=1
15	Q9U8W8	6.21e-50	173	292	0.235	0.353	TL5A_TACTR Techylectin-5A OS=Tachypleus tridentatus OX=6853 PE=1 SV=1
16	O43827	7.72e-50	174	346	0.264	0.335	ANGL7_HUMAN Angiopoietin-related protein 7 OS=Homo sapiens OX=9606 GN=ANGPTL7 PE=1 SV=1
17	Q90Z18	1.23e-49	177	489	0.248	0.223	Q90Z18_DANRE Angiopoietin-2 OS=Danio rerio OX=7955 GN=ang2 PE=2 SV=1
18	Q02020	3.01e-49	176	463	0.253	0.240	FIBB_CHICK Fibrinogen beta chain (Fragment) OS=Gallus gallus OX=9031 GN=FGB PE=1 SV=1
19	Q90Z19	6.85e-49	176	513	0.241	0.207	Q90Z19_DANRE Angiopoietin-1 OS=Danio rerio OX=7955 GN=ang1 PE=2 SV=1
20	Q5KQT9	7.65e-48	173	510	0.216	0.186	Q5KQT9_DANRE Angiopoietin-like 2 OS=Danio rerio OX=7955 GN=Angptl2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10046 BLOC1_2	23	16.8	Biogenesis of lysosome-related organelles complex-1 subunit 2
2	PF16716 BST2	3e+02	13.4	Bone marrow stromal antigen 2
3	PF00170 bZIP_1	4.4e+02	12.4	bZIP transcription factor
4	PF15188 CCDC-167	2.8e+02	13.3	Coiled-coil domain-containing protein 167
5	PF07989 Cnn_1N	2.9e+02	13.0	Centrosomin N-terminal motif 1
6	PF04977 DivIC	16	16.6	Septum formation initiator
7	PF06935 DUF1284	3.4e+02	13.1	Protein of unknown function (DUF1284)
8	PF01519 DUF16	5.3e+02	12.5	Protein of unknown function DUF16
9	PF15397 DUF4618	1e+02	13.7	Domain of unknown function (DUF4618)
10	PF19111 DUF5798	8.9e+02	11.5	Family of unknown function (DUF5798)
11	PF06103 DUF948	5.5e+02	12.2	Bacterial protein of unknown function (DUF948)
12	PF00147 Fibrinogen_C	9e-94	324.9	Fibrinogen beta and gamma chains, C-terminal globular domain
13	PF08702 Fib_alpha	7.3e+02	11.7	Fibrinogen alpha/beta chain family
14	PF05377 FlaC_arch	0.64	21.8	Flagella accessory protein C (FlaC)
15	PF13851 GAS	2.3e+02	12.6	Growth-arrest specific micro-tubule binding
16	PF06009 Laminin_II	1.9e+02	13.5	Laminin Domain II
17	PF04728 LPP	2e+02	13.6	Lipoprotein leucine-zipper
18	PF14712 Snapin_Pallidin	3e+02	13.3	Snapin/Pallidin
19	PF11365 SOGA	58	16.2	Protein SOGA
20	PF14260 zf-C4pol	6.1e+02	12.2	C4-type zinc-finger of DNA polymerase delta

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000248598

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351497	0.991	Low affinity immunoglobulin gamma Fc region receptor II-b
2	9606.ENSP00000392770	0.799	Membrane-spanning 4-domains subfamily A member 6A
3	9606.ENSP00000306099	0.778	Fibrinogen beta chain
4	9606.ENSP00000336829	0.776	Fibrinogen gamma chain
5	9606.ENSP00000420384	0.771	Cystatin-F
6	9606.ENSP00000306361	0.768	Fibrinogen alpha chain
7	9606.ENSP00000346839	0.758	Fibronectin type III domain containing
8	9606.ENSP00000321853	0.756	Alpha-2-antiplasmin
9	9606.ENSP00000262629	0.748	TYRO protein tyrosine kinase-binding protein
10	9606.ENSP00000381133	0.748	Fibrinogen-like protein 1
11	9606.ENSP00000260356	0.746	Thrombospondin-1
12	9606.ENSP00000286301	0.746	Macrophage colony-stimulating factor 1 receptor
13	9606.ENSP00000308541	0.718	Prothrombin
14	9606.ENSP00000357123	0.702	Myeloid cell nuclear differentiation antigen
15	9606.ENSP00000363773	0.698	Complement C1q subcomponent subunit A
16	9606.ENSP00000356430	0.692	Regulator of G-protein signaling 18
17	9606.ENSP00000255945	0.677	GTPase IMAP family member 4
18	9606.ENSP00000357981	0.675	Cathepsin S
19	9606.ENSP00000313967	0.669	Complement C1q subcomponent subunit B
20	9606.ENSP00000352071	0.666	Scavenger receptor cysteine-rich type 1 protein M130

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0098772	0.997	molecular function regulator activity
GO:0005488	0.996	binding
GO:0030234	0.994	enzyme regulator activity
GO:0005515	0.987	protein binding
GO:0140677	0.735	molecular function activator activity
GO:0008047	0.713	enzyme activator activity
GO:0042802	0.407	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.959	multicellular organismal process
GO:0065007	0.866	biological regulation
GO:0009987	0.866	cellular process
GO:0050789	0.858	regulation of biological process
GO:0050794	0.790	regulation of cellular process
GO:0050896	0.645	response to stimulus
GO:0048518	0.433	positive regulation of biological process
GO:0048519	0.428	negative regulation of biological process
GO:0051239	0.409	regulation of multicellular organismal process
GO:0048583	0.409	regulation of response to stimulus
GO:0048522	0.324	positive regulation of cellular process
GO:0051716	0.316	cellular response to stimulus
GO:0048523	0.307	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.998	extracellular region
GO:0012505	0.997	endomembrane system
GO:0070013	0.988	intracellular organelle lumen
GO:0071944	0.981	cell periphery
GO:0043231	0.981	intracellular membrane-bounded organelle
GO:0005886	0.961	plasma membrane
GO:0032991	0.952	protein-containing complex
GO:0005615	0.951	extracellular space
GO:0005737	0.923	cytoplasm
GO:0009986	0.884	cell surface
GO:0031982	0.838	vesicle
GO:0031410	0.816	cytoplasmic vesicle
GO:1903561	0.749	extracellular vesicle
GO:0030141	0.733	secretory granule
GO:0031012	0.660	extracellular matrix
GO:0070062	0.656	extracellular exosome
GO:0062023	0.634	collagen-containing extracellular matrix
GO:0101002	0.438	ficolin-1-rich granule
GO:1904813	0.323	ficolin-1-rich granule lumen
GO:0031981	0.318	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]