StarFunc result for job id Q14318

User Input

>input (412 residues)
MASCAEPSEPSAPLPAGVPPLEDFEVLDGVEDAEGEEEEEEEEEEEDDLSELPPLEDMGQ
PPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKG
QVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYG
PQGRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQERVALANRKRECGNAHYQRADFVLA
ANSYDLAIKAITSSAKVDMTFEEEAQLLQLKVKCLNNLAASQLKLDHYRAALRSCSLVLE
HQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKKHAAQRSTE
TALYRKMLGNPSRLPAKCPGKGAWSIPWKWLFGATAVALGGVALSVVIAARN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1S912	0.705	0.703	4.613E-60	413	0.964	0.961	F1S912.pdb.gz
2	AFDB:Q7K3D4	0.647	0.671	2.377E-25	397	0.265	0.275	Q7K3D4.pdb.gz	Q7K3D4_DROME peptidylprolyl isomerase OS=Drosophila melanogaster OX=7227 GN=zda PE=1 SV=1
3	AFDB:B3H746	0.462	0.359	1.089E-21	562	0.201	0.148	B3H746.pdb.gz	B3H746_ARATH peptidylprolyl isomerase OS=Arabidopsis thaliana OX=3702 GN=ROF1 PE=1 SV=1
4	AFDB:Q9FJL3	0.450	0.342	5.464E-21	578	0.197	0.140	Q9FJL3.pdb.gz	FKB65_ARATH Peptidyl-prolyl cis-trans isomerase FKBP65 OS=Arabidopsis thaliana OX=3702 GN=FKBP65 PE=1 SV=1
5	AFDB:A0A0A0MTJ1	0.302	0.486	6.064E-21	249	0.587	0.972	A0A0A0MTJ1.pdb.gz	A0A0A0MTJ1_HUMAN FKBP prolyl isomerase 8 OS=Homo sapiens OX=9606 GN=FKBP8 PE=1 SV=1
6	AFDB:Q9LDC0	0.367	0.413	1.323E-20	365	0.192	0.216	Q9LDC0.pdb.gz	FKB42_ARATH Peptidyl-prolyl cis-trans isomerase FKBP42 OS=Arabidopsis thaliana OX=3702 GN=FKBP42 PE=1 SV=1
7	AFDB:Q8I4V8	0.415	0.551	4.380E-20	304	0.184	0.250	Q8I4V8.pdb.gz	FKB35_PLAF7 Peptidyl-prolyl cis-trans isomerase FKBP35 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=FKBP35 PE=1 SV=1
8	AFDB:F1NIM4	0.391	0.365	4.861E-20	442	0.209	0.195	F1NIM4.pdb.gz	F1NIM4_CHICK peptidylprolyl isomerase OS=Gallus gallus OX=9031 GN=FKBP4 PE=1 SV=1
9	AFDB:Q9TRY0	0.452	0.414	4.861E-20	459	0.177	0.159	Q9TRY0.pdb.gz	FKBP4_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Bos taurus OX=9913 GN=FKBP4 PE=1 SV=4
10	AFDB:Q7DMA9	0.459	0.320	5.394E-20	635	0.180	0.117	Q7DMA9.pdb.gz	PAS1_ARATH Peptidyl-prolyl cis-trans isomerase PASTICCINO1 OS=Arabidopsis thaliana OX=3702 GN=PAS1 PE=1 SV=2
11	PDB:5njxA	0.433	0.433	1.682E-18	413	0.163	0.162	5njxA.pdb.gz	Combined x-ray crystallography and computational modeling approach to investigate the Hsp90 C-terminal peptide binding to FKBP51.
12	PDB:2if4A	0.290	0.455	2.867E-15	258	0.155	0.248	2if4A.pdb.gz
13	PDB:1ihgA	0.351	0.396	8.013E-10	364	0.138	0.157	1ihgA.pdb.gz
14	PDB:2nd5A	0.241	0.840	2.154E-9	111	0.083	0.306	2nd5A.pdb.gz
15	PDB:7u0sA	0.243	0.781	4.463E-9	124	0.080	0.266	7u0sA.pdb.gz	Structure-Guided Synthesis of FK506 and FK520 Analogs with Increased Selectivity Exhibit In Vivo Therapeutic Efficacy against Cryptococcus.
16	PDB:4c02B	0.240	0.877	5.495E-9	108	0.075	0.287	4c02B.pdb.gz	Crystal Structure of Human Acvr1 (Alk2) in Complex with Fkbp12.6 And Dorsomorphin
17	PDB:7zw0sk	0.242	0.829	5.495E-9	114	0.083	0.298	7zw0sk.pdb.gz	Sensing of individual stalled 80S ribosomes by Fap1 for nonfunctional rRNA turnover.
18	PDB:1fklA	0.236	0.867	2.758E-8	107	0.083	0.318	1fklA.pdb.gz	Comparative X-ray structures of the major binding protein for the immunosuppressant FK506 (tacrolimus) in unliganded form and in complex with FK506 and rapamycin.
19	PDB:4mspA	0.244	0.514	3.060E-8	189	0.085	0.185	4mspA.pdb.gz	Structure of human peptidyl-prolyl cis-trans isomerase FKBP22 containing two EF-hand motifs.
20	PDB:6tz8C	0.240	0.855	3.768E-8	111	0.080	0.297	6tz8C.pdb.gz	Harnessing calcineurin-FK506-FKBP12 crystal structures from invasive fungal pathogens to develop antifungal agents.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O35465	0.0	699	402	0.908	0.930	FKBP8_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP8 OS=Mus musculus OX=10090 GN=Fkbp8 PE=1 SV=2
2	Q14318	0.0	833	412	1.000	1.000	FKBP8_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP8 OS=Homo sapiens OX=9606 GN=FKBP8 PE=1 SV=2
3	U3KQ64	2.33e-125	361	182	0.439	0.995	U3KQ64_HUMAN FKBP prolyl isomerase 8 (Fragment) OS=Homo sapiens OX=9606 GN=FKBP8 PE=1 SV=1
4	A0A0A0MTJ1	1.70e-104	311	249	0.369	0.610	A0A0A0MTJ1_HUMAN FKBP prolyl isomerase 8 OS=Homo sapiens OX=9606 GN=FKBP8 PE=1 SV=1
5	Q7K3D4	2.87e-48	171	397	0.265	0.275	Q7K3D4_DROME peptidylprolyl isomerase OS=Drosophila melanogaster OX=7227 GN=zda PE=1 SV=1
6	Q38931	2.32e-30	124	551	0.216	0.162	FKB62_ARATH Peptidyl-prolyl cis-trans isomerase FKBP62 OS=Arabidopsis thaliana OX=3702 GN=FKBP62 PE=1 SV=2
7	B3H746	9.60e-30	123	562	0.214	0.157	B3H746_ARATH peptidylprolyl isomerase OS=Arabidopsis thaliana OX=3702 GN=ROF1 PE=1 SV=1
8	Q9FJL3	2.55e-27	116	578	0.201	0.144	FKB65_ARATH Peptidyl-prolyl cis-trans isomerase FKBP65 OS=Arabidopsis thaliana OX=3702 GN=FKBP65 PE=1 SV=1
9	Q9LDC0	2.86e-22	99.4	365	0.194	0.219	FKB42_ARATH Peptidyl-prolyl cis-trans isomerase FKBP42 OS=Arabidopsis thaliana OX=3702 GN=FKBP42 PE=1 SV=1
10	P30416	3.86e-22	100	458	0.187	0.168	FKBP4_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Mus musculus OX=10090 GN=Fkbp4 PE=1 SV=5
11	Q9VL78	6.58e-22	99.4	439	0.167	0.157	FKB59_DROME FK506-binding protein 59 OS=Drosophila melanogaster OX=7227 GN=Fkbp59 PE=1 SV=1
12	Q9QVC8	1.95e-21	98.2	458	0.184	0.166	FKBP4_RAT Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Rattus norvegicus OX=10116 GN=Fkbp4 PE=1 SV=3
13	Q9TRY0	5.17e-20	94.0	459	0.180	0.161	FKBP4_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Bos taurus OX=9913 GN=FKBP4 PE=1 SV=4
14	P27124	7.32e-20	93.6	458	0.177	0.159	FKBP4_RABIT Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Oryctolagus cuniculus OX=9986 GN=FKBP4 PE=1 SV=3
15	Q02790	8.38e-20	93.2	459	0.180	0.161	FKBP4_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Homo sapiens OX=9606 GN=FKBP4 PE=1 SV=3
16	F1NIM4	5.84e-17	84.7	442	0.165	0.154	F1NIM4_CHICK peptidylprolyl isomerase OS=Gallus gallus OX=9031 GN=FKBP4 PE=1 SV=1
17	Q5ZJT4	6.82e-17	84.3	442	0.165	0.154	Q5ZJT4_CHICK peptidylprolyl isomerase OS=Gallus gallus OX=9031 GN=RCJMB04_15n8 PE=2 SV=1
18	E5KN55	5.54e-16	81.3	370	0.112	0.124	E5KN55_HUMAN Peptidyl-prolyl cis-trans isomerase D OS=Homo sapiens OX=9606 PE=1 SV=1
19	Q08752	5.54e-16	81.3	370	0.112	0.124	PPID_HUMAN Peptidyl-prolyl cis-trans isomerase D OS=Homo sapiens OX=9606 GN=PPID PE=1 SV=3
20	Q9CR16	1.76e-15	79.7	370	0.107	0.119	PPID_MOUSE Peptidyl-prolyl cis-trans isomerase D OS=Mus musculus OX=10090 GN=Ppid PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12895 ANAPC3	2.1	20.0	Anaphase-promoting complex, cyclosome, subunit 3
2	PF14853 Fis1_TPR_C	0.00083	30.8	Fis1 C-terminal tetratricopeptide repeat
3	PF00254 FKBP_C	2.8e-11	54.9	FKBP-type peptidyl-prolyl cis-trans isomerase
4	PF12569 NatA_aux_su	1.2e+02	13.0	N-terminal acetyltransferase A, auxiliary subunit
5	PF00515 TPR_1	2.7e-09	47.7	Tetratricopeptide repeat
6	PF13374 TPR_10	69	14.7	Tetratricopeptide repeat
7	PF13414 TPR_11	0.01	26.8	TPR repeat
8	PF13424 TPR_12	1.8	20.2	Tetratricopeptide repeat
9	PF13428 TPR_14	8e-06	37.2	Tetratricopeptide repeat
10	PF13432 TPR_16	0.00074	31.4	Tetratricopeptide repeat
11	PF13431 TPR_17	0.64	21.6	Tetratricopeptide repeat
12	PF14559 TPR_19	0.26	23.1	Tetratricopeptide repeat
13	PF07719 TPR_2	1.7e-08	45.0	Tetratricopeptide repeat
14	PF14561 TPR_20	45	15.8	Tetratricopeptide repeat
15	PF13174 TPR_6	47	16.0	Tetratricopeptide repeat
16	PF13176 TPR_7	0.048	24.8	Tetratricopeptide repeat
17	PF13181 TPR_8	0.022	26.0	Tetratricopeptide repeat
18	PF13371 TPR_9	0.015	26.7	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9544.ENSMMUP00000012534

Rank	PPI partner	STRING score	Description
1	9544.ENSMMUP00000008651	0.951	BCL2, apoptosis regulator
2	9544.ENSMMUP00000006946	0.925	Egl-9 family hypoxia inducible factor 1
3	9544.ENSMMUP00000007865	0.922	Bcl-2-like protein 1
4	9544.ENSMMUP00000025391	0.813	Serine/threonine-protein kinase mTOR
5	9544.ENSMMUP00000002781	0.800	Uncharacterized protein
6	9544.ENSMMUP00000010774	0.800	Uncharacterized protein
7	9544.ENSMMUP00000016126	0.800	Uncharacterized protein
8	9544.ENSMMUP00000025472	0.800	Uncharacterized protein
9	9544.ENSMMUP00000021537	0.798	Uncharacterized protein
10	9544.ENSMMUP00000008217	0.781	GTP-binding protein Rheb
11	9544.ENSMMUP00000001600	0.777	Egl-9 family hypoxia inducible factor 2
12	9544.ENSMMUP00000035017	0.767	Mitochondrial Rho GTPase
13	9544.ENSMMUP00000016240	0.755	Uncharacterized protein
14	9544.ENSMMUP00000029862	0.755	Heat shock protein 90kDa alpha (cytosolic), class B member 1
15	9544.ENSMMUP00000006932	0.742	Ubiquitin carboxyl-terminal hydrolase
16	9544.ENSMMUP00000009065	0.742	Mitochondrial ubiquitin ligase activator of NFKB 1
17	9544.ENSMMUP00000023556	0.731	Uncharacterized protein
18	9544.ENSMMUP00000010665	0.720	Protein S100
19	9544.ENSMMUP00000026330	0.719	Translocase of outer mitochondrial membrane 70
20	9544.ENSMMUP00000010805	0.711	Peptidyl-prolyl cis-trans isomerase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0044183	0.411	protein folding chaperone

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0048519	0.989	negative regulation of biological process
GO:0050794	0.970	regulation of cellular process
GO:0006457	0.969	protein folding
GO:0060255	0.623	regulation of macromolecule metabolic process
GO:0007165	0.606	signal transduction
GO:0044419	0.380	biological process involved in interspecies interaction between organisms
GO:0051702	0.359	biological process involved in interaction with symbiont
GO:0048523	0.347	negative regulation of cellular process
GO:0008152	0.333	metabolic process
GO:0050792	0.300	regulation of viral process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.997	endomembrane system
GO:0005783	0.993	endoplasmic reticulum
GO:0016020	0.981	membrane
GO:0005739	0.887	mitochondrion
GO:0005829	0.886	cytosol
GO:0043232	0.391	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]