StarFunc result for job id Q14324

User Input

>input (1141 residues)
MPEAKPAAKKAPKGKDAPKGAPKEAPPKEAPAEAPKEAPPEDQSPTAEEPTGVFLKKPDS
VSVETGKDAVVVAKVNGKELPDKPTIKWFKGKWLELGSKSGARFSFKESHNSASNVYTVE
LHIGKVVLGDRGYYRLEVKAKDTCDSCGFNIDVEAPRQDASGQSLESFKRTSEKKSDTAG
ELDFSGLLKKREVVEEEKKKKKKDDDDLGIPPEIWELLKGAKKSEYEKIAFQYGITDLRG
MLKRLKKAKVEVKKSAAFTKKLDPAYQVDRGNKIKLMVEISDPDLTLKWFKNGQEIKPSS
KYVFENVGKKRILTINKCTLADDAAYEVAVKDEKCFTELFVKEPPVLIVTPLEDQQVFVG
DRVEMAVEVSEEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQ
VITNGGQCEAELIVEEKQLEVLQDIADLTVKASEQAVFKCEVSDEKVTGKWYKNGVEVRP
SKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPK
IHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDC
SSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWAILVWE
PPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIG
VSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGS
EEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKI
RLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVR
QAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDG
NSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGV
SKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVV
WMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEVRVP
Q

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A1L1QZU5	0.373	0.337	0.000	1287	0.578	0.513	A0A1L1QZU5.pdb.gz	A0A1L1QZU5_DANRE Myosin-binding protein C, cardiac-type isoform X4 OS=Danio rerio OX=7955 GN=hm:zehn0716 PE=1 SV=1
2	AFDB:A0A571BEN1	0.230	0.230	0.000	1139	0.488	0.489	A0A571BEN1.pdb.gz	A0A571BEN1_MOUSE Myosin binding protein C, slow-type OS=Mus musculus OX=10090 GN=Mybpc1 PE=1 SV=1
3	AFDB:A5WWB7	0.254	0.252	0.000	1147	0.486	0.483	A5WWB7.pdb.gz
4	AFDB:A6QP89	0.301	0.289	0.000	1198	0.493	0.469	A6QP89.pdb.gz	A6QP89_BOVIN MYBPC1 protein OS=Bos taurus OX=9913 GN=MYBPC1 PE=2 SV=1
5	AFDB:E7EZ79	0.314	0.287	0.000	1266	0.581	0.524	E7EZ79.pdb.gz
6	AFDB:F1R6I7	0.452	0.463	0.000	1111	0.603	0.619	F1R6I7.pdb.gz
7	AFDB:P16419	0.412	0.415	0.000	1132	0.699	0.705	P16419.pdb.gz	MYPC2_CHICK Myosin-binding protein C, fast-type OS=Gallus gallus OX=9031 GN=MYBPC2 PE=1 SV=3
8	AFDB:P56741	0.306	0.280	0.000	1274	0.550	0.492	P56741.pdb.gz	MYPC_RAT Myosin-binding protein C, cardiac-type OS=Rattus norvegicus OX=10116 GN=Mybpc3 PE=1 SV=2
9	AFDB:Q14324	1.000	1.000	0.000	1141	1.000	1.000	Q14324.pdb.gz	MYPC2_HUMAN Myosin-binding protein C, fast-type OS=Homo sapiens OX=9606 GN=MYBPC2 PE=1 SV=2
10	AFDB:Q14896	0.330	0.302	0.000	1274	0.547	0.490	Q14896.pdb.gz	MYPC3_HUMAN Myosin-binding protein C, cardiac-type OS=Homo sapiens OX=9606 GN=MYBPC3 PE=1 SV=4
11	PDB:1e07A	0.117	0.187	2.091E-23	642	0.088	0.156	1e07A.pdb.gz
12	PDB:5oj2B	0.140	0.210	2.228E-22	692	0.110	0.182	5oj2B.pdb.gz
13	PDB:7sqcO0	0.118	0.118	2.252E-19	1140	0.098	0.098	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
14	PDB:5a42A	0.094	0.075	1.552E-15	1597	0.088	0.063	5a42A.pdb.gz
15	PDB:7q1yA	0.143	0.127	9.860E-14	1374	0.082	0.068	7q1yA.pdb.gz
16	PDB:4lnvA	0.095	0.089	2.804E-12	1276	0.076	0.068	4lnvA.pdb.gz
17	PDB:7q5zA	0.093	0.083	2.932E-12	1344	0.072	0.061	7q5zA.pdb.gz
18	PDB:6h03A	0.093	0.089	3.066E-12	1223	0.080	0.074	6h03A.pdb.gz
19	PDB:7vonA	0.088	0.077	4.382E-12	1399	0.081	0.066	7vonA.pdb.gz
20	PDB:2rcjC	0.136	0.217	1.338E-11	523	0.074	0.163	2rcjC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1L1QZU5	0.0	1323	1287	0.578	0.512	A0A1L1QZU5_DANRE Myosin-binding protein C, cardiac-type isoform X4 OS=Danio rerio OX=7955 GN=hm:zehn0716 PE=1 SV=1
2	A0A571BEN1	0.0	1162	1139	0.489	0.490	A0A571BEN1_MOUSE Myosin binding protein C, slow-type OS=Mus musculus OX=10090 GN=Mybpc1 PE=1 SV=1
3	A6QP89	0.0	1150	1198	0.504	0.480	A6QP89_BOVIN MYBPC1 protein OS=Bos taurus OX=9913 GN=MYBPC1 PE=2 SV=1
4	D3YU50	0.0	1164	1127	0.490	0.496	D3YU50_MOUSE Myosin binding protein C, slow-type OS=Mus musculus OX=10090 GN=Mybpc1 PE=1 SV=1
5	F6RQD1	0.0	654	626	0.266	0.486	F6RQD1_MOUSE Myosin binding protein C, slow-type (Fragment) OS=Mus musculus OX=10090 GN=Mybpc1 PE=1 SV=1
6	O70468	0.0	1235	1270	0.547	0.491	MYPC3_MOUSE Myosin-binding protein C, cardiac-type OS=Mus musculus OX=10090 GN=Mybpc3 PE=1 SV=1
7	P16419	0.0	1612	1132	0.689	0.694	MYPC2_CHICK Myosin-binding protein C, fast-type OS=Gallus gallus OX=9031 GN=MYBPC2 PE=1 SV=3
8	P56741	0.0	1259	1274	0.552	0.495	MYPC_RAT Myosin-binding protein C, cardiac-type OS=Rattus norvegicus OX=10116 GN=Mybpc3 PE=1 SV=2
9	Q00872	0.0	1160	1141	0.489	0.489	MYPC1_HUMAN Myosin-binding protein C, slow-type OS=Homo sapiens OX=9606 GN=MYBPC1 PE=1 SV=2
10	Q14324	0.0	2336	1141	1.000	1.000	MYPC2_HUMAN Myosin-binding protein C, fast-type OS=Homo sapiens OX=9606 GN=MYBPC2 PE=1 SV=2
11	Q14896	0.0	1242	1274	0.545	0.488	MYPC3_HUMAN Myosin-binding protein C, cardiac-type OS=Homo sapiens OX=9606 GN=MYBPC3 PE=1 SV=4
12	Q5BJ14	0.0	1408	1111	0.599	0.615	Q5BJ14_DANRE Zgc:110761 OS=Danio rerio OX=7955 GN=zgc:110761 PE=2 SV=1
13	Q5U3B1	0.0	1105	1168	0.488	0.477	Q5U3B1_DANRE Myosin-binding protein C, slow-type OS=Danio rerio OX=7955 GN=zgc:92073 PE=1 SV=1
14	Q5XKE0	0.0	2055	1136	0.906	0.910	MYPC2_MOUSE Myosin-binding protein C, fast-type OS=Mus musculus OX=10090 GN=Mybpc2 PE=1 SV=1
15	Q63518	0.0	610	621	0.259	0.477	MYPC1_RAT Myosin-binding protein C, slow-type (Fragment) OS=Rattus norvegicus OX=10116 GN=Mybpc1 PE=1 SV=1
16	Q6P6L5	0.0	1162	1124	0.491	0.498	Q6P6L5_MOUSE Myosin binding protein C, slow-type OS=Mus musculus OX=10090 GN=Mybpc1 PE=1 SV=1
17	Q86T42	0.0	714	783	0.315	0.458	Q86T42_HUMAN Uncharacterized protein DKFZp451E186 OS=Homo sapiens OX=9606 GN=DKFZp451E186 PE=2 SV=1
18	Q90688	0.0	1293	1272	0.562	0.504	MYPC3_CHICK Myosin-binding protein C, cardiac-type OS=Gallus gallus OX=9031 GN=MYBPC3 PE=1 SV=3
19	Q05623	1.76e-154	473	537	0.190	0.404	MYBPH_CHICK Myosin-binding protein H OS=Gallus gallus OX=9031 GN=MYBPH PE=1 SV=1
20	Q13203	1.37e-151	463	477	0.194	0.463	MYBPH_HUMAN Myosin-binding protein H OS=Homo sapiens OX=9606 GN=MYBPH PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	0.24	23.1	Immunoglobulin C1-set domain
2	PF08205 C2-set_2	0.0037	28.6	CD80-like C2-set immunoglobulin domain
3	PF00041 fn3	2.7e-40	147.9	Fibronectin type III domain
4	PF07679 I-set	3.2e-93	317.3	Immunoglobulin I-set domain
5	PF00047 ig	5.6e-31	117.9	Immunoglobulin domain
6	PF13895 Ig_2	1e-26	104.3	Immunoglobulin domain
7	PF13927 Ig_3	3.4e-61	215.1	Immunoglobulin domain
8	PF16706 Izumo-Ig	1.4e+02	13.8	Izumo-like Immunoglobulin domain
9	PF16656 Pur_ac_phosph_N	1.6e+02	14.3	Purple acid Phosphatase, N-terminal domain
10	PF11465 Receptor_2B4	32	16.2	Natural killer cell receptor 2B4
11	PF18362 THB	4.9e-16	69.3	Tri-helix bundle domain
12	PF07686 V-set	1.6e-13	62.1	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000350332

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000278317	0.921	Troponin T, fast skeletal muscle
2	9606.ENSP00000400908	0.914	Myosin-binding protein C, slow-type
3	9606.ENSP00000442795	0.904	Myosin-binding protein C, cardiac-type
4	9606.ENSP00000361636	0.884	Troponin C, skeletal muscle
5	9606.ENSP00000422007	0.879	Alpha-actinin-3
6	9606.ENSP00000371331	0.867	Troponin I, fast skeletal muscle
7	9606.ENSP00000484342	0.824	Nebulin
8	9606.ENSP00000384330	0.820	Myosin-8
9	9606.ENSP00000467176	0.802	Troponin T, slow skeletal muscle
10	9606.ENSP00000386041	0.794	Myosin-6
11	9606.ENSP00000307280	0.784	Myosin light chain 1/3, skeletal muscle isoform
12	9606.ENSP00000354488	0.774	Troponin I, slow skeletal muscle
13	9606.ENSP00000464317	0.766	Myosin-3
14	9606.ENSP00000228841	0.765	Myosin regulatory light chain 2, ventricular/cardiac muscle isoform
15	9606.ENSP00000379210	0.762	Myosin light chain 3
16	9606.ENSP00000443495	0.760	Alpha-actinin-2
17	9606.ENSP00000367542	0.759	Tropomyosin beta chain
18	9606.ENSP00000232975	0.755	Troponin C, slow skeletal and cardiac muscles
19	9606.ENSP00000236918	0.754	Troponin T, cardiac muscle
20	9606.ENSP00000351022	0.741	Tropomyosin alpha-1 chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008307	0.998	structural constituent of muscle
GO:0008092	0.790	cytoskeletal protein binding
GO:0005200	0.443	structural constituent of cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.994	multicellular organismal process
GO:0003008	0.898	system process
GO:0003012	0.886	muscle system process
GO:0006936	0.862	muscle contraction
GO:0032502	0.792	developmental process
GO:0048856	0.763	anatomical structure development
GO:0065007	0.497	biological regulation
GO:0009987	0.450	cellular process
GO:0050789	0.369	regulation of biological process
GO:0060537	0.367	muscle tissue development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043229	0.996	intracellular organelle
GO:0043232	0.994	intracellular non-membrane-bounded organelle
GO:0005829	0.993	cytosol
GO:0005856	0.933	cytoskeleton
GO:0099512	0.929	supramolecular fiber
GO:0030016	0.916	myofibril
GO:0043227	0.674	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]