StarFunc result for job id Q14353

User Input

>input (236 residues)
MSAPSATPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYMHALAAAASSK
GGRVLEVGFGMAIAASKVQEAPIDEHWIIECNDGVFQRLRDWAPRQTHKVIPLKGLWEDV
APTLPDGHFDGILYDTYPLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGELMKS
KYSDITIMFEETQVPALLEAGFRRENIRTEVMALVPPADCRYYAFPQMITPLVTKG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14353	1.000	1.000	6.295E-56	236	1.000	1.000	Q14353.pdb.gz	GAMT_HUMAN Guanidinoacetate N-methyltransferase OS=Homo sapiens OX=9606 GN=GAMT PE=1 SV=1
2	AFDB:O35969	0.997	0.997	3.182E-52	236	0.877	0.877	O35969.pdb.gz	GAMT_MOUSE Guanidinoacetate N-methyltransferase OS=Mus musculus OX=10090 GN=Gamt PE=1 SV=1
3	PDB:3orhA	0.968	0.993	1.715E-50	230	0.975	1.000	3orhA.pdb.gz	The crystal structure of human guanidinoacetate N-methyltransferase with SAH
4	PDB:1xcjA	0.965	0.995	2.904E-46	229	0.856	0.882	1xcjA.pdb.gz	Catalytic mechanism of guanidinoacetate methyltransferase: crystal structures of guanidinoacetate methyltransferase ternary complexes.
5	AFDB:Q10170	0.713	0.485	5.233E-12	357	0.233	0.154	Q10170.pdb.gz	RMT2_SCHPO Protein arginine N-methyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rmt2 PE=3 SV=2
6	AFDB:Q03305	0.698	0.416	1.359E-11	412	0.199	0.114	Q03305.pdb.gz	RMT2_YEAST Protein arginine N-methyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RMT2 PE=1 SV=1
7	AFDB:A0A1D8PMZ3	0.711	0.397	2.411E-11	451	0.237	0.124	A0A1D8PMZ3.pdb.gz	A0A1D8PMZ3_CANAL Arginine N-methyltransferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RMT2 PE=3 SV=1
8	AFDB:Q93XQ5	0.602	0.386	3.039E-9	388	0.140	0.085	Q93XQ5.pdb.gz	PMT1_NICAT Putrescine N-methyltransferase 1 OS=Nicotiana attenuata OX=49451 GN=PMT1 PE=2 SV=1
9	PDB:6o65B	0.558	0.461	2.005E-8	294	0.144	0.116	6o65B.pdb.gz	Spermidine Synthase (SPDS) Undergoes Concerted Structural Rearrangements Upon Ligand Binding - A Case Study of the Two SPDS Isoforms FromArabidopsis thaliana.
10	AFDB:Q3ED65	0.515	0.471	3.005E-8	261	0.114	0.103	Q3ED65.pdb.gz	MENG_ARATH 2-phytyl-1,4-beta-naphthoquinone methyltransferase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MENG PE=1 SV=2
11	AFDB:Q09741	0.581	0.473	3.412E-8	298	0.144	0.114	Q09741.pdb.gz	SPEE_SCHPO Spermidine synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC12C2.07c PE=3 SV=1
12	AFDB:Q94BN2	0.581	0.404	3.412E-8	359	0.161	0.106	Q94BN2.pdb.gz	SPSY_ARATH Spermine synthase OS=Arabidopsis thaliana OX=3702 GN=SPMS PE=1 SV=1
13	AFDB:Q9ZUB3	0.595	0.436	3.412E-8	334	0.148	0.105	Q9ZUB3.pdb.gz	SPDS1_ARATH Spermidine synthase 1 OS=Arabidopsis thaliana OX=3702 GN=SPDSYN1 PE=1 SV=1
14	PDB:6jclG	0.522	0.557	4.037E-8	219	0.144	0.155	6jclG.pdb.gz	Structural and biochemical characterization of Rv0187, an O-methyltransferase from Mycobacterium tuberculosis.
15	PDB:5x7fA	0.525	0.608	1.269E-7	198	0.131	0.157	5x7fA.pdb.gz	Structure of a O-methyltransferase from Mycobacterium tuberculosis at 2.0 resolution
16	PDB:7wttq	0.473	0.475	3.745E-7	235	0.114	0.115	7wttq.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
17	PDB:4iwnA	0.528	0.543	5.847E-7	229	0.144	0.148	4iwnA.pdb.gz	S-Adenosyl-S-carboxymethyl-L-homocysteine: a novel cofactor found in the putative tRNA-modifying enzyme CmoA.
18	PDB:1jq3A	0.580	0.478	7.077E-7	295	0.131	0.105	1jq3A.pdb.gz	The crystal structure of spermidine synthase with a multisubstrate adduct inhibitor.
19	PDB:2o06A	0.538	0.439	7.542E-7	297	0.157	0.125	2o06A.pdb.gz	Structure and mechanism of spermidine synthases.
20	PDB:3a27A	0.499	0.532	8.566E-7	219	0.136	0.146	3a27A.pdb.gz	Structural basis of AdoMet-dependent aminocarboxypropyl transfer reaction catalyzed by tRNA-wybutosine synthesizing enzyme, TYW2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14353	7.09e-180	494	236	1.000	1.000	GAMT_HUMAN Guanidinoacetate N-methyltransferase OS=Homo sapiens OX=9606 GN=GAMT PE=1 SV=1
2	P10868	1.74e-155	432	236	0.864	0.864	GAMT_RAT Guanidinoacetate N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Gamt PE=1 SV=2
3	O35969	1.17e-154	430	236	0.877	0.877	GAMT_MOUSE Guanidinoacetate N-methyltransferase OS=Mus musculus OX=10090 GN=Gamt PE=1 SV=1
4	Q03305	1.23e-08	57.0	412	0.161	0.092	RMT2_YEAST Protein arginine N-methyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RMT2 PE=1 SV=1
5	Q10170	1.41e-08	56.6	357	0.169	0.112	RMT2_SCHPO Protein arginine N-methyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rmt2 PE=3 SV=2
6	A0A1D8PMZ3	1.79e-05	47.4	451	0.178	0.093	A0A1D8PMZ3_CANAL Arginine N-methyltransferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RMT2 PE=3 SV=1
7	O14321	0.34	34.3	378	0.148	0.093	ERG6_SCHPO Sterol 24-C-methyltransferase erg6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=erg6 PE=2 SV=1
8	P16376	3.2	31.6	746	0.102	0.032	7UP2_DROME Steroid receptor seven-up, isoform A OS=Drosophila melanogaster OX=7227 GN=svp PE=2 SV=3
9	F1R9W4	4.8	30.8	3044	0.081	0.006	F1R9W4_DANRE Cadherin EGF LAG seven-pass G-type receptor 1 isoform X2 OS=Danio rerio OX=7955 GN=celsr1a PE=1 SV=3
10	P49802	7.3	30.0	495	0.131	0.063	RGS7_HUMAN Regulator of G-protein signaling 7 OS=Homo sapiens OX=9606 GN=RGS7 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13649 Methyltransf_25	3.3	19.8	Methyltransferase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003846120.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003831512.1	0.998	Glycine amidinotransferase
2	9597.XP_003817584.1	0.989	Belongs to the ATP:guanido phosphotransferase family.
3	9597.XP_003804271.1	0.967	Belongs to the ATP:guanido phosphotransferase family.
4	9597.XP_003807112.2	0.962	Belongs to the ATP:guanido phosphotransferase family.
5	9597.XP_003822312.1	0.961	Belongs to the ATP:guanido phosphotransferase family.
6	9597.XP_003806714.1	0.828	BRX1, biogenesis of ribosomes
7	9597.XP_003804557.1	0.824	DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.
8	9597.XP_003820819.1	0.816	Component of the PeBoW complex, which is required for maturation of 28S and 5.8S ribosomal RNAs and formation of the 60S ribosome
9	9597.XP_008975239.1	0.812	Pumilio RNA binding family member 3
10	9597.XP_003819553.1	0.811	Component of the PeBoW complex, which is required for maturation of 28S and 5.8S ribosomal RNAs and formation of the 60S ribosome
11	9597.XP_003822251.1	0.810	Ribosome production factor 2 homolog
12	9597.XP_008976873.1	0.810	Proliferation-associated protein 2G4
13	9597.XP_003825313.1	0.809	WD repeat-containing protein 75
14	9597.XP_003832586.1	0.809	PWP1 homolog, endonuclein
15	9597.XP_003832350.1	0.806	Required for 60S pre-ribosomal subunits export to the cytoplasm
16	9597.XP_008950778.1	0.803	WD repeat-containing protein 43
17	9597.XP_003814602.1	0.800	NIP7, nucleolar pre-rRNA processing protein
18	9597.XP_003827664.1	0.800	tRNA (guanine(10)-N2)-methyltransferase homolog isoform X1
19	9597.XP_003832856.1	0.800	ATP-dependent RNA helicase DDX24
20	9597.XP_003825077.1	0.799	TWIST neighbor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030731	0.998	guanidinoacetate N-methyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0071704	0.994	organic substance metabolic process
GO:0044237	0.994	cellular metabolic process
GO:0006807	0.991	nitrogen compound metabolic process
GO:0006575	0.884	cellular modified amino acid metabolic process
GO:0044281	0.873	small molecule metabolic process
GO:0009058	0.847	biosynthetic process
GO:0042398	0.814	cellular modified amino acid biosynthetic process
GO:0032501	0.811	multicellular organismal process
GO:0019752	0.760	carboxylic acid metabolic process
GO:0032787	0.751	monocarboxylic acid metabolic process
GO:0044283	0.750	small molecule biosynthetic process
GO:0044249	0.742	cellular biosynthetic process
GO:0072330	0.733	monocarboxylic acid biosynthetic process
GO:0044238	0.641	primary metabolic process
GO:0034641	0.598	cellular nitrogen compound metabolic process
GO:0046483	0.561	heterocycle metabolic process
GO:0006139	0.553	nucleobase-containing compound metabolic process
GO:0065007	0.358	biological regulation
GO:0050789	0.353	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0032991	0.605	protein-containing complex
GO:0016020	0.512	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10656	0.998	guanidinoacetate + S-adenosyl-L-methionine = creatine + H(+) + S-adenosyl-L-homocysteine
EC:2.1.1.2	0.998	guanidinoacetate N-methyltransferase.

[back to server]