StarFunc result for job id Q14376

User Input

>input (348 residues)
MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSV
EFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMK
AHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNA
VLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRD
YIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARR
EGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14376	1.000	1.000	1.270E-77	348	1.000	1.000	Q14376.pdb.gz	GALE_HUMAN UDP-glucose 4-epimerase OS=Homo sapiens OX=9606 GN=GALE PE=1 SV=2
2	PDB:1i3kA	0.994	0.997	2.167E-71	347	0.991	0.994	1i3kA.pdb.gz	Molecular basis for severe epimerase deficiency galactosemia. X-ray structure of the human V94m-substituted UDP-galactose 4-epimerase.
3	AFDB:Q9W0P5	0.974	0.969	6.650E-55	350	0.603	0.600	Q9W0P5.pdb.gz	GALE_DROME UDP-glucose 4-epimerase OS=Drosophila melanogaster OX=7227 GN=Gale PE=1 SV=1
4	AFDB:Q564Q1	0.967	0.964	8.470E-53	349	0.563	0.562	Q564Q1.pdb.gz	GALE_CAEEL UDP-glucose 4-epimerase OS=Caenorhabditis elegans OX=6239 GN=gale-1 PE=1 SV=1
5	AFDB:Q9SN58	0.954	0.946	5.293E-52	351	0.598	0.593	Q9SN58.pdb.gz	UGE5_ARATH UDP-glucose 4-epimerase 5 OS=Arabidopsis thaliana OX=3702 GN=UGE5 PE=1 SV=3
6	AFDB:Q42605	0.962	0.954	8.493E-52	351	0.552	0.547	Q42605.pdb.gz	UGE1_ARATH Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 1 OS=Arabidopsis thaliana OX=3702 GN=UGE1 PE=1 SV=2
7	AFDB:B0M3E8	0.951	0.946	1.211E-51	350	0.552	0.549	B0M3E8.pdb.gz	UGE1_PEA Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 1 OS=Pisum sativum OX=3888 GN=UGE1 PE=1 SV=2
8	AFDB:Q9T0A7	0.947	0.941	1.211E-51	350	0.589	0.586	Q9T0A7.pdb.gz	UGE2_ARATH UDP-glucose 4-epimerase 2 OS=Arabidopsis thaliana OX=3702 GN=UGE2 PE=1 SV=1
9	AFDB:E8MF10	0.945	0.967	2.947E-50	340	0.540	0.553	E8MF10.pdb.gz	GALE_BIFL2 UDP-glucose 4-epimerase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=lnpD PE=1 SV=1
10	AFDB:Q9Y7X5	0.952	0.933	6.741E-50	355	0.537	0.527	Q9Y7X5.pdb.gz	UGE1_SCHPO UDP-glucose 4-epimerase uge1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=uge1 PE=1 SV=1
11	AFDB:Q9C7W7	0.955	0.955	9.059E-50	348	0.566	0.566	Q9C7W7.pdb.gz	UGE4_ARATH UDP-glucose 4-epimerase 4 OS=Arabidopsis thaliana OX=3702 GN=UGE4 PE=1 SV=1
12	PDB:4lisA	0.935	0.894	4.178E-47	364	0.523	0.500	4lisA.pdb.gz	Elucidation of Substrate Specificity in Aspergillus nidulans UDP-Galactose-4-Epimerase.
13	PDB:6k0gA	0.929	0.965	6.320E-47	335	0.540	0.561	6k0gA.pdb.gz	Structural basis for broad substrate specificity of UDP-glucose 4-epimerase in the human milk oligosaccharide catabolic pathway of Bifidobacterium longum.
14	PDB:1a9yA	0.950	0.978	2.061E-46	338	0.509	0.524	1a9yA.pdb.gz	Dramatic differences in the binding of UDP-galactose and UDP-glucose to UDP-galactose 4-epimerase from Escherichia coli.
15	PDB:1z45A	0.902	0.469	5.351E-43	674	0.503	0.260	1z45A.pdb.gz	The molecular architecture of galactose mutarotase/UDP-galactose 4-epimerase from Saccharomyces cerevisiae.
16	PDB:1gy8C	0.903	0.850	1.490E-35	370	0.379	0.357	1gy8C.pdb.gz	High-Resolution Crystal Structure of Trypanosoma Brucei Udp-Galactose 4'-Epimerase: A Potential Target for Structure-Based Development of Novel Trypanocides
17	PDB:6lttA	0.818	0.911	7.119E-25	311	0.256	0.286	6lttA.pdb.gz
18	PDB:1keuA	0.783	0.757	1.364E-24	361	0.261	0.252	1keuA.pdb.gz	Toward a structural understanding of the dehydratase mechanism.
19	PDB:5in4A	0.788	0.774	8.034E-24	355	0.204	0.200	5in4A.pdb.gz	Facile Modulation of Antibody Fucosylation with Small Molecule Fucostatin Inhibitors and Cocrystal Structure with GDP-Mannose 4,6-Dehydratase.
20	PDB:1rpnD	0.795	0.855	1.018E-23	322	0.213	0.230	1rpnD.pdb.gz	Crystal structure of a tetrameric GDP-D-mannose 4,6-dehydratase from a bacterial GDP-D-rhamnose biosynthetic pathway.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14376	0.0	726	348	1.000	1.000	GALE_HUMAN UDP-glucose 4-epimerase OS=Homo sapiens OX=9606 GN=GALE PE=1 SV=2
2	Q8R059	0.0	678	347	0.934	0.937	GALE_MOUSE UDP-glucose 4-epimerase OS=Mus musculus OX=10090 GN=Gale PE=1 SV=1
3	Q9W0P5	8.51e-159	450	350	0.598	0.594	GALE_DROME UDP-glucose 4-epimerase OS=Drosophila melanogaster OX=7227 GN=Gale PE=1 SV=1
4	Q9SN58	2.31e-148	424	351	0.601	0.595	UGE5_ARATH UDP-glucose 4-epimerase 5 OS=Arabidopsis thaliana OX=3702 GN=UGE5 PE=1 SV=3
5	Q9T0A7	1.28e-145	417	350	0.592	0.589	UGE2_ARATH UDP-glucose 4-epimerase 2 OS=Arabidopsis thaliana OX=3702 GN=UGE2 PE=1 SV=1
6	Q564Q1	8.65e-144	412	349	0.569	0.567	GALE_CAEEL UDP-glucose 4-epimerase OS=Caenorhabditis elegans OX=6239 GN=gale-1 PE=1 SV=1
7	Q9C7W7	3.33e-135	390	348	0.566	0.566	UGE4_ARATH UDP-glucose 4-epimerase 4 OS=Arabidopsis thaliana OX=3702 GN=UGE4 PE=1 SV=1
8	Q42605	5.54e-135	390	351	0.555	0.550	UGE1_ARATH Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 1 OS=Arabidopsis thaliana OX=3702 GN=UGE1 PE=1 SV=2
9	B0M3E8	3.42e-134	388	350	0.552	0.549	UGE1_PEA Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 1 OS=Pisum sativum OX=3888 GN=UGE1 PE=1 SV=2
10	Q9Y7X5	2.96e-132	383	355	0.540	0.530	UGE1_SCHPO UDP-glucose 4-epimerase uge1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=uge1 PE=1 SV=1
11	E8MF10	3.61e-132	382	340	0.540	0.553	GALE_BIFL2 UDP-glucose 4-epimerase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=lnpD PE=1 SV=1
12	Q8LDN8	1.15e-130	379	351	0.546	0.541	UGE3_ARATH Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 3 OS=Arabidopsis thaliana OX=3702 GN=UGE3 PE=1 SV=1
13	P09147	1.21e-129	376	338	0.514	0.530	GALE_ECOLI UDP-glucose 4-epimerase OS=Escherichia coli (strain K12) OX=83333 GN=galE PE=1 SV=1
14	Q6A1A4	3.94e-127	369	338	0.497	0.512	Q6A1A4_AERHY UDP-glucose 4-epimerase OS=Aeromonas hydrophila OX=644 GN=galE PE=3 SV=2
15	C8VAU8	3.80e-123	360	371	0.532	0.499	C8VAU8_EMENI UDP-glucose 4-epimerase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_04727 PE=1 SV=1
16	P04397	9.01e-123	370	699	0.543	0.270	GAL10_YEAST Bifunctional protein GAL10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GAL10 PE=1 SV=2
17	Q4WV46	1.91e-122	358	371	0.526	0.493	Q4WV46_ASPFU UDP-glucose 4-epimerase OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_5G10780 PE=3 SV=1
18	A0A1D8PCN0	1.32e-120	364	675	0.509	0.262	A0A1D8PCN0_CANAL Bifunctional UDP-glucose 4-epimerase/aldose 1-epimerase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GAL10 PE=4 SV=1
19	Q9HDU3	2.29e-120	365	713	0.523	0.255	GAL10_SCHPO Bifunctional protein gal10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gal10 PE=3 SV=1
20	Q4WX18	1.18e-85	267	428	0.443	0.360	Q4WX18_ASPFU UDP-glucose 4-epimerase, putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_3G07910 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01073 3Beta_HSD	8.4e-13	59.5	3-beta hydroxysteroid dehydrogenase/isomerase family
2	PF00106 adh_short	1.5	19.8	short chain dehydrogenase
3	PF01370 Epimerase	5.7e-47	171.8	NAD dependent epimerase/dehydratase family
4	PF16363 GDP_Man_Dehyd	1.9e-57	206.8	GDP-mannose 4,6 dehydratase
5	PF08659 KR	0.0062	28.0	KR domain
6	PF13460 NAD_binding_10	0.038	25.4	NAD(P)H-binding
7	PF07993 NAD_binding_4	0.00055	30.8	Male sterility protein
8	PF05368 NmrA	1.1	20.3	NmrA-like family
9	PF02719 Polysacc_synt_2	2.6e-06	38.5	Polysaccharide biosynthesis protein
10	PF04321 RmlD_sub_bind	4.3e-08	44.2	RmlD substrate binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000483375

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368119	0.999	Galactose-1-phosphate uridylyltransferase
2	9606.ENSP00000338703	0.990	UTP--glucose-1-phosphate uridylyltransferase
3	9606.ENSP00000465930	0.986	Galactokinase
4	9606.ENSP00000319501	0.985	UDP-glucose 6-dehydrogenase
5	9606.ENSP00000453129	0.980	N-acetylgalactosamine kinase
6	9606.ENSP00000356903	0.966	UDP-N-acetylhexosamine pyrophosphorylase
7	9606.ENSP00000272252	0.964	Aldose 1-epimerase
8	9606.ENSP00000369055	0.938	Beta-1,4-galactosyltransferase 1
9	9606.ENSP00000451792	0.937	Uncharacterized protein
10	9606.ENSP00000301046	0.935	Alpha-lactalbumin
11	9606.ENSP00000310696	0.914	Beta-1,4-galactosyltransferase 2
12	9606.ENSP00000221804	0.900	Galectin-10
13	9606.ENSP00000379839	0.865	Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase
14	9606.ENSP00000318318	0.796	Mannose-6-phosphate isomerase
15	9606.ENSP00000357980	0.754	Serine protease HTRA1
16	9606.ENSP00000370194	0.718	GDP-mannose 4,6 dehydratase
17	9606.ENSP00000300107	0.689	ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial
18	9606.ENSP00000369820	0.688	Phosphatidylinositol N-acetylglucosaminyltransferase subunit A
19	9606.ENSP00000398803	0.669	GDP-L-fucose synthase
20	9606.ENSP00000405573	0.666	Glucose-6-phosphate isomerase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003978	1.000	UDP-glucose 4-epimerase activity
GO:0005515	0.993	protein binding
GO:0042802	0.893	identical protein binding
GO:0016491	0.323	oxidoreductase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006012	0.997	galactose metabolic process
GO:1901575	0.986	organic substance catabolic process
GO:0016052	0.979	carbohydrate catabolic process
GO:0009987	0.936	cellular process
GO:0044282	0.936	small molecule catabolic process
GO:0046365	0.912	monosaccharide catabolic process
GO:0044237	0.845	cellular metabolic process
GO:0006807	0.758	nitrogen compound metabolic process
GO:0019320	0.571	hexose catabolic process
GO:1901360	0.523	organic cyclic compound metabolic process
GO:1901135	0.474	carbohydrate derivative metabolic process
GO:1901576	0.468	organic substance biosynthetic process
GO:0006725	0.377	cellular aromatic compound metabolic process
GO:0046483	0.367	heterocycle metabolic process
GO:1901564	0.362	organonitrogen compound metabolic process
GO:0034641	0.351	cellular nitrogen compound metabolic process
GO:0006793	0.346	phosphorus metabolic process
GO:0006139	0.344	nucleobase-containing compound metabolic process
GO:0055086	0.333	nucleobase-containing small molecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043227	0.713	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:22168	1.000	UDP-alpha-D-glucose = UDP-alpha-D-galactose
EC:5.1.3.2	1.000	UDP-glucose 4-epimerase.
EC:1.-.-.-	0.323	Oxidoreductases.

[back to server]